diff options
Diffstat (limited to 'src/dma/vendor/golang.org/x/text/internal/language')
20 files changed, 8865 insertions, 0 deletions
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/common.go b/src/dma/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 00000000..cdfdb749 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact.go b/src/dma/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 00000000..46a00150 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/compact.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 00000000..1b36935e --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/gen.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen.go new file mode 100644 index 00000000..0c36a052 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen.go @@ -0,0 +1,64 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// Language tag table generator. +// Data read from the web. + +package main + +import ( + "flag" + "fmt" + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", + false, + "test existing tables; can be used to compare web data with package data.") + outputFile = flag.String("output", + "tables.go", + "output file for generated tables") +) + +func main() { + gen.Init() + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "compact") + + fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`) + + b := newBuilder(w) + gen.WriteCLDRVersion(w) + + b.writeCompactIndex() +} + +type builder struct { + w *gen.CodeWriter + data *cldr.CLDR + supp *cldr.SupplementalData +} + +func newBuilder(w *gen.CodeWriter) *builder { + r := gen.OpenCLDRCoreZip() + defer r.Close() + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatal(err) + } + b := builder{ + w: w, + data: data, + supp: data.Supplemental(), + } + return &b +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_index.go new file mode 100644 index 00000000..136cefaf --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_index.go @@ -0,0 +1,113 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// This file generates derivative tables based on the language package itself. + +import ( + "fmt" + "log" + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// Compact indices: +// Note -va-X variants only apply to localization variants. +// BCP variants only ever apply to language. +// The only ambiguity between tags is with regions. + +func (b *builder) writeCompactIndex() { + // Collect all language tags for which we have any data in CLDR. + m := map[language.Tag]bool{} + for _, lang := range b.data.Locales() { + // We include all locales unconditionally to be consistent with en_US. + // We want en_US, even though it has no data associated with it. + + // TODO: put any of the languages for which no data exists at the end + // of the index. This allows all components based on ICU to use that + // as the cutoff point. + // if x := data.RawLDML(lang); false || + // x.LocaleDisplayNames != nil || + // x.Characters != nil || + // x.Delimiters != nil || + // x.Measurement != nil || + // x.Dates != nil || + // x.Numbers != nil || + // x.Units != nil || + // x.ListPatterns != nil || + // x.Collations != nil || + // x.Segmentations != nil || + // x.Rbnf != nil || + // x.Annotations != nil || + // x.Metadata != nil { + + // TODO: support POSIX natively, albeit non-standard. + tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) + m[tag] = true + // } + } + + // TODO: plural rules are also defined for the deprecated tags: + // iw mo sh tl + // Consider removing these as compact tags. + + // Include locales for plural rules, which uses a different structure. + for _, plurals := range b.supp.Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + m[language.Make(lang)] = true + } + } + } + + var coreTags []language.CompactCoreInfo + var special []string + + for t := range m { + if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { + log.Fatalf("Unexpected extension %v in %v", x, t) + } + if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { + cci, ok := language.GetCompactCore(t) + if !ok { + log.Fatalf("Locale for non-basic language %q", t) + } + coreTags = append(coreTags, cci) + } else { + special = append(special, t.String()) + } + } + + w := b.w + + sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] }) + sort.Strings(special) + + w.WriteComment(` + NumCompactTags is the number of common tags. The maximum tag is + NumCompactTags-1.`) + w.WriteConst("NumCompactTags", len(m)) + + fmt.Fprintln(w, "const (") + for i, t := range coreTags { + fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i) + } + for i, t := range special { + fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags)) + } + fmt.Fprintln(w, ")") + + w.WriteVar("coreTags", coreTags) + + w.WriteConst("specialTagsStr", strings.Join(special, " ")) +} + +func ident(s string) string { + return strings.Replace(s, "-", "", -1) + "Index" +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_parents.go new file mode 100644 index 00000000..9543d583 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_parents.go @@ -0,0 +1,54 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/unicode/cldr" +) + +func main() { + r := gen.OpenCLDRCoreZip() + defer r.Close() + + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatalf("DecodeZip: %v", err) + } + + w := gen.NewCodeWriter() + defer w.WriteGoFile("parents.go", "compact") + + // Create parents table. + type ID uint16 + parents := make([]ID, compact.NumCompactTags) + for _, loc := range data.Locales() { + tag := language.MustParse(loc) + index, ok := compact.FromTag(tag) + if !ok { + continue + } + parentIndex := compact.ID(0) // und + for p := tag.Parent(); p != language.Und; p = p.Parent() { + if x, ok := compact.FromTag(p); ok { + parentIndex = x + break + } + } + parents[index] = ID(parentIndex) + } + + w.WriteComment(` + parents maps a compact index of a tag to the compact index of the parent of + this tag.`) + w.WriteVar("parents", parents) +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/language.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 00000000..83816a72 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/parents.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 00000000..8d810723 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/tables.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 00000000..554ca354 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x0581f000, + 0x0581f032, 0x05857000, 0x05857032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000, + 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105, + 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd, + 0x43257105, 0x4325714d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000, + 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000, + 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000, + 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000, + 0x528000ba, 0x52900000, 0x52938000, 0x52938053, + 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000, + // Entry 300 - 31F + 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: F4E57D15 diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/tags.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 00000000..ca135d29 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compose.go b/src/dma/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 00000000..4ae78e0f --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/coverage.go b/src/dma/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 00000000..9b20b88f --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/gen.go b/src/dma/vendor/golang.org/x/text/internal/language/gen.go new file mode 100644 index 00000000..cdcc7feb --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/gen.go @@ -0,0 +1,1520 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// Language tag table generator. +// Data read from the web. + +package main + +import ( + "bufio" + "flag" + "fmt" + "io" + "io/ioutil" + "log" + "math" + "reflect" + "regexp" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/tag" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", + false, + "test existing tables; can be used to compare web data with package data.") + outputFile = flag.String("output", + "tables.go", + "output file for generated tables") +) + +var comment = []string{ + ` +lang holds an alphabetically sorted list of ISO-639 language identifiers. +All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +For 2-byte language identifiers, the two successive bytes have the following meaning: + - if the first letter of the 2- and 3-letter ISO codes are the same: + the second and third letter of the 3-letter ISO code. + - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +For 3-byte language identifiers the 4th byte is 0.`, + ` +langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +in lookup tables. The language ids for these language codes are derived directly +from the letters and are not consecutive.`, + ` +altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +to 2-letter language codes that cannot be derived using the method described above. +Each 3-letter code is followed by its 1-byte langID.`, + ` +altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, + ` +AliasMap maps langIDs to their suggested replacements.`, + ` +script is an alphabetically sorted list of ISO 15924 codes. The index +of the script in the string, divided by 4, is the internal scriptID.`, + ` +isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +the UN.M49 codes used for groups.)`, + ` +regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +Each 2-letter codes is followed by two bytes with the following meaning: + - [A-Z}{2}: the first letter of the 2-letter code plus these two + letters form the 3-letter ISO code. + - 0, n: index into altRegionISO3.`, + ` +regionTypes defines the status of a region for various standards.`, + ` +m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +codes indicating collections of regions.`, + ` +m49Index gives indexes into fromM49 based on the three most significant bits +of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in + fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +The region code is stored in the 9 lsb of the indexed value.`, + ` +fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, + ` +altRegionISO3 holds a list of 3-letter region codes that cannot be +mapped to 2-letter codes using the default algorithm. This is a short list.`, + ` +altRegionIDs holds a list of regionIDs the positions of which match those +of the 3-letter ISO codes in altRegionISO3.`, + ` +variantNumSpecialized is the number of specialized variants in variants.`, + ` +suppressScript is an index from langID to the dominant script for that language, +if it exists. If a script is given, it should be suppressed from the language tag.`, + ` +likelyLang is a lookup table, indexed by langID, for the most likely +scripts and regions given incomplete information. If more entries exist for a +given language, region and script are the index and size respectively +of the list in likelyLangList.`, + ` +likelyLangList holds lists info associated with likelyLang.`, + ` +likelyRegion is a lookup table, indexed by regionID, for the most likely +languages and scripts given incomplete information. If more entries exist +for a given regionID, lang and script are the index and size respectively +of the list in likelyRegionList. +TODO: exclude containers and user-definable regions from the list.`, + ` +likelyRegionList holds lists info associated with likelyRegion.`, + ` +likelyScript is a lookup table, indexed by scriptID, for the most likely +languages and regions given a script.`, + ` +nRegionGroups is the number of region groups.`, + ` +regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +where each set holds all groupings that are directly connected in a region +containment graph.`, + ` +regionInclusionBits is an array of bit vectors where every vector represents +a set of region groupings. These sets are used to compute the distance +between two regions for the purpose of language matching.`, + ` +regionInclusionNext marks, for each entry in regionInclusionBits, the set of +all groups that are reachable from the groups set in the respective entry.`, +} + +// TODO: consider changing some of these structures to tries. This can reduce +// memory, but may increase the need for memory allocations. This could be +// mitigated if we can piggyback on language tags for common cases. + +func failOnError(e error) { + if e != nil { + log.Panic(e) + } +} + +type setType int + +const ( + Indexed setType = 1 + iota // all elements must be of same size + Linear +) + +type stringSet struct { + s []string + sorted, frozen bool + + // We often need to update values after the creation of an index is completed. + // We include a convenience map for keeping track of this. + update map[string]string + typ setType // used for checking. +} + +func (ss *stringSet) clone() stringSet { + c := *ss + c.s = append([]string(nil), c.s...) + return c +} + +func (ss *stringSet) setType(t setType) { + if ss.typ != t && ss.typ != 0 { + log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) + } +} + +// parse parses a whitespace-separated string and initializes ss with its +// components. +func (ss *stringSet) parse(s string) { + scan := bufio.NewScanner(strings.NewReader(s)) + scan.Split(bufio.ScanWords) + for scan.Scan() { + ss.add(scan.Text()) + } +} + +func (ss *stringSet) assertChangeable() { + if ss.frozen { + log.Panic("attempt to modify a frozen stringSet") + } +} + +func (ss *stringSet) add(s string) { + ss.assertChangeable() + ss.s = append(ss.s, s) + ss.sorted = ss.frozen +} + +func (ss *stringSet) freeze() { + ss.compact() + ss.frozen = true +} + +func (ss *stringSet) compact() { + if ss.sorted { + return + } + a := ss.s + sort.Strings(a) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + a[k+1] = a[i] + k++ + } + } + ss.s = a[:k+1] + ss.sorted = ss.frozen +} + +type funcSorter struct { + fn func(a, b string) bool + sort.StringSlice +} + +func (s funcSorter) Less(i, j int) bool { + return s.fn(s.StringSlice[i], s.StringSlice[j]) +} + +func (ss *stringSet) sortFunc(f func(a, b string) bool) { + ss.compact() + sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) +} + +func (ss *stringSet) remove(s string) { + ss.assertChangeable() + if i, ok := ss.find(s); ok { + copy(ss.s[i:], ss.s[i+1:]) + ss.s = ss.s[:len(ss.s)-1] + } +} + +func (ss *stringSet) replace(ol, nu string) { + ss.s[ss.index(ol)] = nu + ss.sorted = ss.frozen +} + +func (ss *stringSet) index(s string) int { + ss.setType(Indexed) + i, ok := ss.find(s) + if !ok { + if i < len(ss.s) { + log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) + } + log.Panicf("find: item %q is not in list", s) + + } + return i +} + +func (ss *stringSet) find(s string) (int, bool) { + ss.compact() + i := sort.SearchStrings(ss.s, s) + return i, i != len(ss.s) && ss.s[i] == s +} + +func (ss *stringSet) slice() []string { + ss.compact() + return ss.s +} + +func (ss *stringSet) updateLater(v, key string) { + if ss.update == nil { + ss.update = map[string]string{} + } + ss.update[v] = key +} + +// join joins the string and ensures that all entries are of the same length. +func (ss *stringSet) join() string { + ss.setType(Indexed) + n := len(ss.s[0]) + for _, s := range ss.s { + if len(s) != n { + log.Panicf("join: not all entries are of the same length: %q", s) + } + } + ss.s = append(ss.s, strings.Repeat("\xff", n)) + return strings.Join(ss.s, "") +} + +// ianaEntry holds information for an entry in the IANA Language Subtag Repository. +// All types use the same entry. +// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various +// fields. +type ianaEntry struct { + typ string + description []string + scope string + added string + preferred string + deprecated string + suppressScript string + macro string + prefix []string +} + +type builder struct { + w *gen.CodeWriter + hw io.Writer // MultiWriter for w and w.Hash + data *cldr.CLDR + supp *cldr.SupplementalData + + // indices + locale stringSet // common locales + lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data + langNoIndex stringSet // 3-letter ISO codes with no associated data + script stringSet // 4-letter ISO codes + region stringSet // 2-letter ISO or 3-digit UN M49 codes + variant stringSet // 4-8-alphanumeric variant code. + + // Region codes that are groups with their corresponding group IDs. + groups map[int]index + + // langInfo + registry map[string]*ianaEntry +} + +type index uint + +func newBuilder(w *gen.CodeWriter) *builder { + r := gen.OpenCLDRCoreZip() + defer r.Close() + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + failOnError(err) + b := builder{ + w: w, + hw: io.MultiWriter(w, w.Hash), + data: data, + supp: data.Supplemental(), + } + b.parseRegistry() + return &b +} + +func (b *builder) parseRegistry() { + r := gen.OpenIANAFile("assignments/language-subtag-registry") + defer r.Close() + b.registry = make(map[string]*ianaEntry) + + scan := bufio.NewScanner(r) + scan.Split(bufio.ScanWords) + var record *ianaEntry + for more := scan.Scan(); more; { + key := scan.Text() + more = scan.Scan() + value := scan.Text() + switch key { + case "Type:": + record = &ianaEntry{typ: value} + case "Subtag:", "Tag:": + if s := strings.SplitN(value, "..", 2); len(s) > 1 { + for a := s[0]; a <= s[1]; a = inc(a) { + b.addToRegistry(a, record) + } + } else { + b.addToRegistry(value, record) + } + case "Suppress-Script:": + record.suppressScript = value + case "Added:": + record.added = value + case "Deprecated:": + record.deprecated = value + case "Macrolanguage:": + record.macro = value + case "Preferred-Value:": + record.preferred = value + case "Prefix:": + record.prefix = append(record.prefix, value) + case "Scope:": + record.scope = value + case "Description:": + buf := []byte(value) + for more = scan.Scan(); more; more = scan.Scan() { + b := scan.Bytes() + if b[0] == '%' || b[len(b)-1] == ':' { + break + } + buf = append(buf, ' ') + buf = append(buf, b...) + } + record.description = append(record.description, string(buf)) + continue + default: + continue + } + more = scan.Scan() + } + if scan.Err() != nil { + log.Panic(scan.Err()) + } +} + +func (b *builder) addToRegistry(key string, entry *ianaEntry) { + if info, ok := b.registry[key]; ok { + if info.typ != "language" || entry.typ != "extlang" { + log.Fatalf("parseRegistry: tag %q already exists", key) + } + } else { + b.registry[key] = entry + } +} + +var commentIndex = make(map[string]string) + +func init() { + for _, s := range comment { + key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) + commentIndex[key] = s + } +} + +func (b *builder) comment(name string) { + if s := commentIndex[name]; len(s) > 0 { + b.w.WriteComment(s) + } else { + fmt.Fprintln(b.w) + } +} + +func (b *builder) pf(f string, x ...interface{}) { + fmt.Fprintf(b.hw, f, x...) + fmt.Fprint(b.hw, "\n") +} + +func (b *builder) p(x ...interface{}) { + fmt.Fprintln(b.hw, x...) +} + +func (b *builder) addSize(s int) { + b.w.Size += s + b.pf("// Size: %d bytes", s) +} + +func (b *builder) writeConst(name string, x interface{}) { + b.comment(name) + b.w.WriteConst(name, x) +} + +// writeConsts computes f(v) for all v in values and writes the results +// as constants named _v to a single constant block. +func (b *builder) writeConsts(f func(string) int, values ...string) { + b.pf("const (") + for _, v := range values { + b.pf("\t_%s = %v", v, f(v)) + } + b.pf(")") +} + +// writeType writes the type of the given value, which must be a struct. +func (b *builder) writeType(value interface{}) { + b.comment(reflect.TypeOf(value).Name()) + b.w.WriteType(value) +} + +func (b *builder) writeSlice(name string, ss interface{}) { + b.writeSliceAddSize(name, 0, ss) +} + +func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { + b.comment(name) + b.w.Size += extraSize + v := reflect.ValueOf(ss) + t := v.Type().Elem() + b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) + + fmt.Fprintf(b.w, "var %s = ", name) + b.w.WriteArray(ss) + b.p() +} + +type FromTo struct { + From, To uint16 +} + +func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { + ss.sortFunc(func(a, b string) bool { + return index(a) < index(b) + }) + m := []FromTo{} + for _, s := range ss.s { + m = append(m, FromTo{index(s), index(ss.update[s])}) + } + b.writeSlice(name, m) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s string) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +func (b *builder) writeBitVector(name string, ss []string) { + vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) + for _, s := range ss { + v := strToInt(s) + vec[v/8] |= 1 << (v % 8) + } + b.writeSlice(name, vec) +} + +// TODO: convert this type into a list or two-stage trie. +func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size())) + for _, k := range m { + sz += len(k) + } + b.addSize(sz) + keys := []string{} + b.pf(`var %s = map[string]uint16{`, name) + for k := range m { + keys = append(keys, k) + } + sort.Strings(keys) + for _, k := range keys { + b.pf("\t%q: %v,", k, f(m[k])) + } + b.p("}") +} + +func (b *builder) writeMap(name string, m interface{}) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) + b.addSize(sz) + f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { + return strings.IndexRune("{}, ", r) != -1 + }) + sort.Strings(f[1:]) + b.pf(`var %s = %s{`, name, f[0]) + for _, kv := range f[1:] { + b.pf("\t%s,", kv) + } + b.p("}") +} + +func (b *builder) langIndex(s string) uint16 { + if s == "und" { + return 0 + } + if i, ok := b.lang.find(s); ok { + return uint16(i) + } + return uint16(strToInt(s)) + uint16(len(b.lang.s)) +} + +// inc advances the string to its lexicographical successor. +func inc(s string) string { + const maxTagLength = 4 + var buf [maxTagLength]byte + intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) + for i := 0; i < len(s); i++ { + if s[i] <= 'Z' { + buf[i] -= 'a' - 'A' + } + } + return string(buf[:len(s)]) +} + +func (b *builder) parseIndices() { + meta := b.supp.Metadata + + for k, v := range b.registry { + var ss *stringSet + switch v.typ { + case "language": + if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { + b.lang.add(k) + continue + } else { + ss = &b.langNoIndex + } + case "region": + ss = &b.region + case "script": + ss = &b.script + case "variant": + ss = &b.variant + default: + continue + } + ss.add(k) + } + // Include any language for which there is data. + for _, lang := range b.data.Locales() { + if x := b.data.RawLDML(lang); false || + x.LocaleDisplayNames != nil || + x.Characters != nil || + x.Delimiters != nil || + x.Measurement != nil || + x.Dates != nil || + x.Numbers != nil || + x.Units != nil || + x.ListPatterns != nil || + x.Collations != nil || + x.Segmentations != nil || + x.Rbnf != nil || + x.Annotations != nil || + x.Metadata != nil { + + from := strings.Split(lang, "_") + if lang := from[0]; lang != "root" { + b.lang.add(lang) + } + } + } + // Include locales for plural rules, which uses a different structure. + for _, plurals := range b.data.Supplemental().Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + if lang = strings.Split(lang, "_")[0]; lang != "root" { + b.lang.add(lang) + } + } + } + } + // Include languages in likely subtags. + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + b.lang.add(from[0]) + } + // Include ISO-639 alpha-3 bibliographic entries. + for _, a := range meta.Alias.LanguageAlias { + if a.Reason == "bibliographic" { + b.langNoIndex.add(a.Type) + } + } + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 { + b.region.add(reg.Type) + } + } + + for _, s := range b.lang.s { + if len(s) == 3 { + b.langNoIndex.remove(s) + } + } + b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) + b.writeConst("NumScripts", len(b.script.slice())) + b.writeConst("NumRegions", len(b.region.slice())) + + // Add dummy codes at the start of each list to represent "unspecified". + b.lang.add("---") + b.script.add("----") + b.region.add("---") + + // common locales + b.locale.parse(meta.DefaultContent.Locales) +} + +// TODO: region inclusion data will probably not be use used in future matchers. + +func (b *builder) computeRegionGroups() { + b.groups = make(map[int]index) + + // Create group indices. + for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. + b.groups[i] = index(len(b.groups)) + } + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + if _, ok := b.groups[group]; !ok { + b.groups[group] = index(len(b.groups)) + } + } + if len(b.groups) > 64 { + log.Fatalf("only 64 groups supported, found %d", len(b.groups)) + } + b.writeConst("nRegionGroups", len(b.groups)) +} + +var langConsts = []string{ + "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", + "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", + "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", + "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", + "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", + "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", + + // constants for grandfathered tags (if not already defined) + "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", + "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", +} + +// writeLanguage generates all tables needed for language canonicalization. +func (b *builder) writeLanguage() { + meta := b.supp.Metadata + + b.writeConst("nonCanonicalUnd", b.lang.index("und")) + b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) + b.writeConst("langPrivateStart", b.langIndex("qaa")) + b.writeConst("langPrivateEnd", b.langIndex("qtz")) + + // Get language codes that need to be mapped (overlong 3-letter codes, + // deprecated 2-letter codes, legacy and grandfathered tags.) + langAliasMap := stringSet{} + aliasTypeMap := map[string]AliasType{} + + // altLangISO3 get the alternative ISO3 names that need to be mapped. + altLangISO3 := stringSet{} + // Add dummy start to avoid the use of index 0. + altLangISO3.add("---") + altLangISO3.updateLater("---", "aa") + + lang := b.lang.clone() + for _, a := range meta.Alias.LanguageAlias { + if a.Replacement == "" { + a.Replacement = "und" + } + // TODO: support mapping to tags + repl := strings.SplitN(a.Replacement, "_", 2)[0] + if a.Reason == "overlong" { + if len(a.Replacement) == 2 && len(a.Type) == 3 { + lang.updateLater(a.Replacement, a.Type) + } + } else if len(a.Type) <= 3 { + switch a.Reason { + case "macrolanguage": + aliasTypeMap[a.Type] = Macro + case "deprecated": + // handled elsewhere + continue + case "bibliographic", "legacy": + if a.Type == "no" { + continue + } + aliasTypeMap[a.Type] = Legacy + default: + log.Fatalf("new %s alias: %s", a.Reason, a.Type) + } + langAliasMap.add(a.Type) + langAliasMap.updateLater(a.Type, repl) + } + } + // Manually add the mapping of "nb" (Norwegian) to its macro language. + // This can be removed if CLDR adopts this change. + langAliasMap.add("nb") + langAliasMap.updateLater("nb", "no") + aliasTypeMap["nb"] = Macro + + for k, v := range b.registry { + // Also add deprecated values for 3-letter ISO codes, which CLDR omits. + if v.typ == "language" && v.deprecated != "" && v.preferred != "" { + langAliasMap.add(k) + langAliasMap.updateLater(k, v.preferred) + aliasTypeMap[k] = Deprecated + } + } + // Fix CLDR mappings. + lang.updateLater("tl", "tgl") + lang.updateLater("sh", "hbs") + lang.updateLater("mo", "mol") + lang.updateLater("no", "nor") + lang.updateLater("tw", "twi") + lang.updateLater("nb", "nob") + lang.updateLater("ak", "aka") + lang.updateLater("bh", "bih") + + // Ensure that each 2-letter code is matched with a 3-letter code. + for _, v := range lang.s[1:] { + s, ok := lang.update[v] + if !ok { + if s, ok = lang.update[langAliasMap.update[v]]; !ok { + continue + } + lang.update[v] = s + } + if v[0] != s[0] { + altLangISO3.add(s) + altLangISO3.updateLater(s, v) + } + } + + // Complete canonicalized language tags. + lang.freeze() + for i, v := range lang.s { + // We can avoid these manual entries by using the IANA registry directly. + // Seems easier to update the list manually, as changes are rare. + // The panic in this loop will trigger if we miss an entry. + add := "" + if s, ok := lang.update[v]; ok { + if s[0] == v[0] { + add = s[1:] + } else { + add = string([]byte{0, byte(altLangISO3.index(s))}) + } + } else if len(v) == 3 { + add = "\x00" + } else { + log.Panicf("no data for long form of %q", v) + } + lang.s[i] += add + } + b.writeConst("lang", tag.Index(lang.join())) + + b.writeConst("langNoIndexOffset", len(b.lang.s)) + + // space of all valid 3-letter language identifiers. + b.writeBitVector("langNoIndex", b.langNoIndex.slice()) + + altLangIndex := []uint16{} + for i, s := range altLangISO3.slice() { + altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) + if i > 0 { + idx := b.lang.index(altLangISO3.update[s]) + altLangIndex = append(altLangIndex, uint16(idx)) + } + } + b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) + b.writeSlice("altLangIndex", altLangIndex) + + b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex) + types := make([]AliasType, len(langAliasMap.s)) + for i, s := range langAliasMap.s { + types[i] = aliasTypeMap[s] + } + b.writeSlice("AliasTypes", types) +} + +var scriptConsts = []string{ + "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy", + "Zzzz", +} + +func (b *builder) writeScript() { + b.writeConsts(b.script.index, scriptConsts...) + b.writeConst("script", tag.Index(b.script.join())) + + supp := make([]uint8, len(b.lang.slice())) + for i, v := range b.lang.slice()[1:] { + if sc := b.registry[v].suppressScript; sc != "" { + supp[i+1] = uint8(b.script.index(sc)) + } + } + b.writeSlice("suppressScript", supp) + + // There is only one deprecated script in CLDR. This value is hard-coded. + // We check here if the code must be updated. + for _, a := range b.supp.Metadata.Alias.ScriptAlias { + if a.Type != "Qaai" { + log.Panicf("unexpected deprecated stript %q", a.Type) + } + } +} + +func parseM49(s string) int16 { + if len(s) == 0 { + return 0 + } + v, err := strconv.ParseUint(s, 10, 10) + failOnError(err) + return int16(v) +} + +var regionConsts = []string{ + "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", + "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. +} + +func (b *builder) writeRegion() { + b.writeConsts(b.region.index, regionConsts...) + + isoOffset := b.region.index("AA") + m49map := make([]int16, len(b.region.slice())) + fromM49map := make(map[int16]int) + altRegionISO3 := "" + altRegionIDs := []uint16{} + + b.writeConst("isoRegionOffset", isoOffset) + + // 2-letter region lookup and mapping to numeric codes. + regionISO := b.region.clone() + regionISO.s = regionISO.s[isoOffset:] + regionISO.sorted = false + + regionTypes := make([]byte, len(b.region.s)) + + // Is the region valid BCP 47? + for s, e := range b.registry { + if len(s) == 2 && s == strings.ToUpper(s) { + i := b.region.index(s) + for _, d := range e.description { + if strings.Contains(d, "Private use") { + regionTypes[i] = iso3166UserAssigned + } + } + regionTypes[i] |= bcp47Region + } + } + + // Is the region a valid ccTLD? + r := gen.OpenIANAFile("domains/root/db") + defer r.Close() + + buf, err := ioutil.ReadAll(r) + failOnError(err) + re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) + for _, m := range re.FindAllSubmatch(buf, -1) { + i := b.region.index(strings.ToUpper(string(m[1]))) + regionTypes[i] |= ccTLD + } + + b.writeSlice("regionTypes", regionTypes) + + iso3Set := make(map[string]int) + update := func(iso2, iso3 string) { + i := regionISO.index(iso2) + if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { + regionISO.s[i] += iso3[1:] + iso3Set[iso3] = -1 + } else { + if ok && j >= 0 { + regionISO.s[i] += string([]byte{0, byte(j)}) + } else { + iso3Set[iso3] = len(altRegionISO3) + regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) + altRegionISO3 += iso3 + altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + i := regionISO.index(tc.Type) + isoOffset + if d := m49map[i]; d != 0 { + log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) + } + m49 := parseM49(tc.Numeric) + m49map[i] = m49 + if r := fromM49map[m49]; r == 0 { + fromM49map[m49] = i + } else if r != i { + dep := b.registry[regionISO.s[r-isoOffset]].deprecated + if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { + fromM49map[m49] = i + } + } + } + for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { + if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { + from := parseM49(ta.Type) + if r := fromM49map[from]; r == 0 { + fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + if len(tc.Alpha3) == 3 { + update(tc.Type, tc.Alpha3) + } + } + // This entries are not included in territoryCodes. Mostly 3-letter variants + // of deleted codes and an entry for QU. + for _, m := range []struct{ iso2, iso3 string }{ + {"CT", "CTE"}, + {"DY", "DHY"}, + {"HV", "HVO"}, + {"JT", "JTN"}, + {"MI", "MID"}, + {"NH", "NHB"}, + {"NQ", "ATN"}, + {"PC", "PCI"}, + {"PU", "PUS"}, + {"PZ", "PCZ"}, + {"RH", "RHO"}, + {"VD", "VDR"}, + {"WK", "WAK"}, + // These three-letter codes are used for others as well. + {"FQ", "ATF"}, + } { + update(m.iso2, m.iso3) + } + for i, s := range regionISO.s { + if len(s) != 4 { + regionISO.s[i] = s + " " + } + } + b.writeConst("regionISO", tag.Index(regionISO.join())) + b.writeConst("altRegionISO3", altRegionISO3) + b.writeSlice("altRegionIDs", altRegionIDs) + + // Create list of deprecated regions. + // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only + // Transitionally-reserved mapping not included. + regionOldMap := stringSet{} + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { + regionOldMap.add(reg.Type) + regionOldMap.updateLater(reg.Type, reg.Replacement) + i, _ := regionISO.find(reg.Type) + j, _ := regionISO.find(reg.Replacement) + if k := m49map[i+isoOffset]; k == 0 { + m49map[i+isoOffset] = m49map[j+isoOffset] + } + } + } + b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { + return uint16(b.region.index(s)) + }) + // 3-digit region lookup, groupings. + for i := 1; i < isoOffset; i++ { + m := parseM49(b.region.s[i]) + m49map[i] = m + fromM49map[m] = i + } + b.writeSlice("m49", m49map) + + const ( + searchBits = 7 + regionBits = 9 + ) + if len(m49map) >= 1<<regionBits { + log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits) + } + m49Index := [9]int16{} + fromM49 := []uint16{} + m49 := []int{} + for k, _ := range fromM49map { + m49 = append(m49, int(k)) + } + sort.Ints(m49) + for _, k := range m49[1:] { + val := (k & (1<<searchBits - 1)) << regionBits + fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)])) + m49Index[1:][k>>searchBits] = int16(len(fromM49)) + } + b.writeSlice("m49Index", m49Index) + b.writeSlice("fromM49", fromM49) +} + +const ( + // TODO: put these lists in regionTypes as user data? Could be used for + // various optimizations and refinements and could be exposed in the API. + iso3166Except = "AC CP DG EA EU FX IC SU TA UK" + iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. + // DY and RH are actually not deleted, but indeterminately reserved. + iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" +) + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func find(list []string, s string) int { + for i, t := range list { + if t == s { + return i + } + } + return -1 +} + +// writeVariants generates per-variant information and creates a map from variant +// name to index value. We assign index values such that sorting multiple +// variants by index value will result in the correct order. +// There are two types of variants: specialized and general. Specialized variants +// are only applicable to certain language or language-script pairs. Generalized +// variants apply to any language. Generalized variants always sort after +// specialized variants. We will therefore always assign a higher index value +// to a generalized variant than any other variant. Generalized variants are +// sorted alphabetically among themselves. +// Specialized variants may also sort after other specialized variants. Such +// variants will be ordered after any of the variants they may follow. +// We assume that if a variant x is followed by a variant y, then for any prefix +// p of x, p-x is a prefix of y. This allows us to order tags based on the +// maximum of the length of any of its prefixes. +// TODO: it is possible to define a set of Prefix values on variants such that +// a total order cannot be defined to the point that this algorithm breaks. +// In other words, we cannot guarantee the same order of variants for the +// future using the same algorithm or for non-compliant combinations of +// variants. For this reason, consider using simple alphabetic sorting +// of variants and ignore Prefix restrictions altogether. +func (b *builder) writeVariant() { + generalized := stringSet{} + specialized := stringSet{} + specializedExtend := stringSet{} + // Collate the variants by type and check assumptions. + for _, v := range b.variant.slice() { + e := b.registry[v] + if len(e.prefix) == 0 { + generalized.add(v) + continue + } + c := strings.Split(e.prefix[0], "-") + hasScriptOrRegion := false + if len(c) > 1 { + _, hasScriptOrRegion = b.script.find(c[1]) + if !hasScriptOrRegion { + _, hasScriptOrRegion = b.region.find(c[1]) + + } + } + if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { + // Variant is preceded by a language. + specialized.add(v) + continue + } + // Variant is preceded by another variant. + specializedExtend.add(v) + prefix := c[0] + "-" + if hasScriptOrRegion { + prefix += c[1] + } + for _, p := range e.prefix { + // Verify that the prefix minus the last element is a prefix of the + // predecessor element. + i := strings.LastIndex(p, "-") + pred := b.registry[p[i+1:]] + if find(pred.prefix, p[:i]) < 0 { + log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) + } + // The sorting used below does not work in the general case. It works + // if we assume that variants that may be followed by others only have + // prefixes of the same length. Verify this. + count := strings.Count(p[:i], "-") + for _, q := range pred.prefix { + if c := strings.Count(q, "-"); c != count { + log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) + } + } + if !strings.HasPrefix(p, prefix) { + log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) + } + } + } + + // Sort extended variants. + a := specializedExtend.s + less := func(v, w string) bool { + // Sort by the maximum number of elements. + maxCount := func(s string) (max int) { + for _, p := range b.registry[s].prefix { + if c := strings.Count(p, "-"); c > max { + max = c + } + } + return + } + if cv, cw := maxCount(v), maxCount(w); cv != cw { + return cv < cw + } + // Sort by name as tie breaker. + return v < w + } + sort.Sort(funcSorter{less, sort.StringSlice(a)}) + specializedExtend.frozen = true + + // Create index from variant name to index. + variantIndex := make(map[string]uint8) + add := func(s []string) { + for _, v := range s { + variantIndex[v] = uint8(len(variantIndex)) + } + } + add(specialized.slice()) + add(specializedExtend.s) + numSpecialized := len(variantIndex) + add(generalized.slice()) + if n := len(variantIndex); n > 255 { + log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) + } + b.writeMap("variantIndex", variantIndex) + b.writeConst("variantNumSpecialized", numSpecialized) +} + +func (b *builder) writeLanguageInfo() { +} + +// writeLikelyData writes tables that are used both for finding parent relations and for +// language matching. Each entry contains additional bits to indicate the status of the +// data to know when it cannot be used for parent relations. +func (b *builder) writeLikelyData() { + const ( + isList = 1 << iota + scriptInFrom + regionInFrom + ) + type ( // generated types + likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 + } + likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 + } + likelyLangRegion struct { + lang uint16 + region uint16 + } + // likelyTag is used for getting likely tags for group regions, where + // the likely region might be a region contained in the group. + likelyTag struct { + lang uint16 + region uint16 + script uint8 + } + ) + var ( // generated variables + likelyRegionGroup = make([]likelyTag, len(b.groups)) + likelyLang = make([]likelyScriptRegion, len(b.lang.s)) + likelyRegion = make([]likelyLangScript, len(b.region.s)) + likelyScript = make([]likelyLangRegion, len(b.script.s)) + likelyLangList = []likelyScriptRegion{} + likelyRegionList = []likelyLangScript{} + ) + type fromTo struct { + from, to []string + } + langToOther := map[int][]fromTo{} + regionToOther := map[int][]fromTo{} + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + to := strings.Split(m.To, "_") + if len(to) != 3 { + log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) + } + if len(from) > 3 { + log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) + } + if from[0] != to[0] && from[0] != "und" { + log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) + } + if len(from) == 3 { + if from[2] != to[2] { + log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) + } + if from[0] != "und" { + log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) + } + } + if len(from) == 1 || from[0] != "und" { + id := 0 + if from[0] != "und" { + id = b.lang.index(from[0]) + } + langToOther[id] = append(langToOther[id], fromTo{from, to}) + } else if len(from) == 2 && len(from[1]) == 4 { + sid := b.script.index(from[1]) + likelyScript[sid].lang = uint16(b.langIndex(to[0])) + likelyScript[sid].region = uint16(b.region.index(to[2])) + } else { + r := b.region.index(from[len(from)-1]) + if id, ok := b.groups[r]; ok { + if from[0] != "und" { + log.Fatalf("region changed unexpectedly: %s -> %s", from, to) + } + likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) + likelyRegionGroup[id].script = uint8(b.script.index(to[1])) + likelyRegionGroup[id].region = uint16(b.region.index(to[2])) + } else { + regionToOther[r] = append(regionToOther[r], fromTo{from, to}) + } + } + } + b.writeType(likelyLangRegion{}) + b.writeSlice("likelyScript", likelyScript) + + for id := range b.lang.s { + list := langToOther[id] + if len(list) == 1 { + likelyLang[id].region = uint16(b.region.index(list[0].to[2])) + likelyLang[id].script = uint8(b.script.index(list[0].to[1])) + } else if len(list) > 1 { + likelyLang[id].flags = isList + likelyLang[id].region = uint16(len(likelyLangList)) + likelyLang[id].script = uint8(len(list)) + for _, x := range list { + flags := uint8(0) + if len(x.from) > 1 { + if x.from[1] == x.to[2] { + flags = regionInFrom + } else { + flags = scriptInFrom + } + } + likelyLangList = append(likelyLangList, likelyScriptRegion{ + region: uint16(b.region.index(x.to[2])), + script: uint8(b.script.index(x.to[1])), + flags: flags, + }) + } + } + } + // TODO: merge suppressScript data with this table. + b.writeType(likelyScriptRegion{}) + b.writeSlice("likelyLang", likelyLang) + b.writeSlice("likelyLangList", likelyLangList) + + for id := range b.region.s { + list := regionToOther[id] + if len(list) == 1 { + likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) + likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) + if len(list[0].from) > 2 { + likelyRegion[id].flags = scriptInFrom + } + } else if len(list) > 1 { + likelyRegion[id].flags = isList + likelyRegion[id].lang = uint16(len(likelyRegionList)) + likelyRegion[id].script = uint8(len(list)) + for i, x := range list { + if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { + log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) + } + x := likelyLangScript{ + lang: uint16(b.langIndex(x.to[0])), + script: uint8(b.script.index(x.to[1])), + } + if len(list[0].from) > 2 { + x.flags = scriptInFrom + } + likelyRegionList = append(likelyRegionList, x) + } + } + } + b.writeType(likelyLangScript{}) + b.writeSlice("likelyRegion", likelyRegion) + b.writeSlice("likelyRegionList", likelyRegionList) + + b.writeType(likelyTag{}) + b.writeSlice("likelyRegionGroup", likelyRegionGroup) +} + +func (b *builder) writeRegionInclusionData() { + var ( + // mm holds for each group the set of groups with a distance of 1. + mm = make(map[int][]index) + + // containment holds for each group the transitive closure of + // containment of other groups. + containment = make(map[index][]index) + ) + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + groupIdx := b.groups[group] + for _, mem := range strings.Split(g.Contains, " ") { + r := b.region.index(mem) + mm[r] = append(mm[r], groupIdx) + if g, ok := b.groups[r]; ok { + mm[group] = append(mm[group], g) + containment[groupIdx] = append(containment[groupIdx], g) + } + } + } + + regionContainment := make([]uint64, len(b.groups)) + for _, g := range b.groups { + l := containment[g] + + // Compute the transitive closure of containment. + for i := 0; i < len(l); i++ { + l = append(l, containment[l[i]]...) + } + + // Compute the bitmask. + regionContainment[g] = 1 << g + for _, v := range l { + regionContainment[g] |= 1 << v + } + } + b.writeSlice("regionContainment", regionContainment) + + regionInclusion := make([]uint8, len(b.region.s)) + bvs := make(map[uint64]index) + // Make the first bitvector positions correspond with the groups. + for r, i := range b.groups { + bv := uint64(1 << i) + for _, g := range mm[r] { + bv |= 1 << g + } + bvs[bv] = i + regionInclusion[r] = uint8(bvs[bv]) + } + for r := 1; r < len(b.region.s); r++ { + if _, ok := b.groups[r]; !ok { + bv := uint64(0) + for _, g := range mm[r] { + bv |= 1 << g + } + if bv == 0 { + // Pick the world for unspecified regions. + bv = 1 << b.groups[b.region.index("001")] + } + if _, ok := bvs[bv]; !ok { + bvs[bv] = index(len(bvs)) + } + regionInclusion[r] = uint8(bvs[bv]) + } + } + b.writeSlice("regionInclusion", regionInclusion) + regionInclusionBits := make([]uint64, len(bvs)) + for k, v := range bvs { + regionInclusionBits[v] = uint64(k) + } + // Add bit vectors for increasingly large distances until a fixed point is reached. + regionInclusionNext := []uint8{} + for i := 0; i < len(regionInclusionBits); i++ { + bits := regionInclusionBits[i] + next := bits + for i := uint(0); i < uint(len(b.groups)); i++ { + if bits&(1<<i) != 0 { + next |= regionInclusionBits[i] + } + } + if _, ok := bvs[next]; !ok { + bvs[next] = index(len(bvs)) + regionInclusionBits = append(regionInclusionBits, next) + } + regionInclusionNext = append(regionInclusionNext, uint8(bvs[next])) + } + b.writeSlice("regionInclusionBits", regionInclusionBits) + b.writeSlice("regionInclusionNext", regionInclusionNext) +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +func (b *builder) writeParents() { + b.writeType(parentRel{}) + + parents := []parentRel{} + + // Construct parent overrides. + n := 0 + for _, p := range b.data.Supplemental().ParentLocales.ParentLocale { + // Skipping non-standard scripts to root is implemented using addTags. + if p.Parent == "root" { + continue + } + + sub := strings.Split(p.Parent, "_") + parent := parentRel{lang: b.langIndex(sub[0])} + if len(sub) == 2 { + // TODO: check that all undefined scripts are indeed Latn in these + // cases. + parent.maxScript = uint8(b.script.index("Latn")) + parent.toRegion = uint16(b.region.index(sub[1])) + } else { + parent.script = uint8(b.script.index(sub[1])) + parent.maxScript = parent.script + parent.toRegion = uint16(b.region.index(sub[2])) + } + for _, c := range strings.Split(p.Locales, " ") { + region := b.region.index(c[strings.LastIndex(c, "_")+1:]) + parent.fromRegion = append(parent.fromRegion, uint16(region)) + } + parents = append(parents, parent) + n += len(parent.fromRegion) + } + b.writeSliceAddSize("parents", n*2, parents) +} + +func main() { + gen.Init() + + gen.Repackage("gen_common.go", "common.go", "language") + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "language") + + fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`) + + b := newBuilder(w) + gen.WriteCLDRVersion(w) + + b.parseIndices() + b.writeType(FromTo{}) + b.writeLanguage() + b.writeScript() + b.writeRegion() + b.writeVariant() + // TODO: b.writeLocale() + b.computeRegionGroups() + b.writeLikelyData() + b.writeRegionInclusionData() + b.writeParents() +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/gen_common.go b/src/dma/vendor/golang.org/x/text/internal/language/gen_common.go new file mode 100644 index 00000000..c419ceeb --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/gen_common.go @@ -0,0 +1,20 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/src/dma/vendor/golang.org/x/text/internal/language/language.go b/src/dma/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 00000000..1e74d1af --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,596 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +func (t Tag) TypeForKey(key string) string { + if start, end, _ := t.findTypeForKey(key); end != start { + return t.str[start:end] + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, end, _ := t.findTypeForKey(key) + if start != end { + // Remove key tag and leading '-'. + start -= 4 + + // Remove a possible empty extension. + if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, end, hasExt := t.findTypeForKey(key) + if start == end { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + // p points to the hyphen preceding the current token. + if p3 := p + 3; s[p3] == '-' { + // Found a key. + // Check whether we just processed the key that was requested. + if curKey == key { + return start, p, true + } + // Set to the next key and continue scanning type tokens. + curKey = s[p+1 : p3] + if curKey > key { + return p, p, true + } + // Start of the type token sequence. + start = p + 4 + // A type is at least 3 characters long. + p += 7 // 4 + 3 + } else { + // Attribute or type, which is at least 3 characters long. + p += 4 + } + // p points past the third character of a type or attribute. + max := p + 5 // maximum length of token plus hyphen. + if len(s) < max { + max = len(s) + } + for ; p < max && s[p] != '-'; p++ { + } + // Bail if we have exhausted all tokens or if the next token starts + // a new extension. + if p == len(s) || s[p+2] == '-' { + if curKey == key { + return start, p, true + } + return p, p, true + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Language, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/lookup.go b/src/dma/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 00000000..6294b815 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// mapLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<<regionBits - 1 + ) + idx := n >> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint8 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/match.go b/src/dma/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 00000000..75a2dbca --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/parse.go b/src/dma/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 00000000..2be83e1d --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,594 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + if end < cap(s.b) { + b := make([]byte, len(s.b)+diff) + copy(b, s.b[:oldStart]) + copy(b[end:], s.b[oldEnd:]) + s.b = b + } else { + s.b = append(s.b[end:], s.b[oldEnd:]...) + } + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +func parseTag(scan *scanner) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent + // to a tag of the form <extlang>. + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + copy(scan.b[langStart:], lang.String()) + scan.b[langStart+3] = '-' + scan.start = langStart + 4 + } + scan.gobble(e) + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + keyEnd := scan.end + end = scan.acceptMinSize(3) + // TODO: check key value validity + if keyEnd == end || bytes.Compare(key, last) != 1 { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart, keyEnd := scan.start, scan.end + end = scan.acceptMinSize(3) + if keyEnd != end { + keys = append(keys, scan.b[keyStart:end]) + } else { + scan.setError(ErrSyntax) + end = keyStart + } + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -<char>- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/src/dma/vendor/golang.org/x/text/internal/language/tables.go b/src/dma/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 00000000..239e2d29 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3431 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8665 + +const NumScripts = 242 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, + 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 656 bytes, 164 elements +var AliasMap = [164]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x73e, To: 0x21a1}, + 20: {From: 0x7b3, To: 0x56}, + 21: {From: 0x7b9, To: 0x299b}, + 22: {From: 0x7c5, To: 0x58}, + 23: {From: 0x7e6, To: 0x145}, + 24: {From: 0x80c, To: 0x5a}, + 25: {From: 0x815, To: 0x8d}, + 26: {From: 0x87e, To: 0x810}, + 27: {From: 0x8c3, To: 0xee3}, + 28: {From: 0x9ef, To: 0x331}, + 29: {From: 0xa36, To: 0x2c5}, + 30: {From: 0xa3d, To: 0xbf}, + 31: {From: 0xabe, To: 0x3322}, + 32: {From: 0xb38, To: 0x529}, + 33: {From: 0xb75, To: 0x265a}, + 34: {From: 0xb7e, To: 0xbc3}, + 35: {From: 0xb9b, To: 0x44e}, + 36: {From: 0xbbc, To: 0x4229}, + 37: {From: 0xbbf, To: 0x529}, + 38: {From: 0xbfe, To: 0x2da7}, + 39: {From: 0xc2e, To: 0x3181}, + 40: {From: 0xcb9, To: 0xf3}, + 41: {From: 0xd08, To: 0xfa}, + 42: {From: 0xdc8, To: 0x11a}, + 43: {From: 0xdd7, To: 0x32d}, + 44: {From: 0xdf8, To: 0xdfb}, + 45: {From: 0xdfe, To: 0x531}, + 46: {From: 0xedf, To: 0x205a}, + 47: {From: 0xeee, To: 0x2e9a}, + 48: {From: 0xf39, To: 0x367}, + 49: {From: 0x10d0, To: 0x140}, + 50: {From: 0x1104, To: 0x2d0}, + 51: {From: 0x11a0, To: 0x1ec}, + 52: {From: 0x1279, To: 0x21}, + 53: {From: 0x1424, To: 0x15e}, + 54: {From: 0x1470, To: 0x14e}, + 55: {From: 0x151f, To: 0xd9b}, + 56: {From: 0x1523, To: 0x390}, + 57: {From: 0x1532, To: 0x19f}, + 58: {From: 0x1580, To: 0x210}, + 59: {From: 0x1583, To: 0x10d}, + 60: {From: 0x15a3, To: 0x3caf}, + 61: {From: 0x166a, To: 0x19b}, + 62: {From: 0x16c8, To: 0x136}, + 63: {From: 0x1700, To: 0x29f8}, + 64: {From: 0x1718, To: 0x194}, + 65: {From: 0x1727, To: 0xf3f}, + 66: {From: 0x177a, To: 0x178}, + 67: {From: 0x1809, To: 0x17b6}, + 68: {From: 0x1816, To: 0x18f3}, + 69: {From: 0x188a, To: 0x436}, + 70: {From: 0x1979, To: 0x1d01}, + 71: {From: 0x1a74, To: 0x2bb0}, + 72: {From: 0x1a8a, To: 0x1f8}, + 73: {From: 0x1b5a, To: 0x1fa}, + 74: {From: 0x1b86, To: 0x1515}, + 75: {From: 0x1d64, To: 0x2c9b}, + 76: {From: 0x2038, To: 0x37b1}, + 77: {From: 0x203d, To: 0x20dd}, + 78: {From: 0x205a, To: 0x30b}, + 79: {From: 0x20e3, To: 0x274}, + 80: {From: 0x20ee, To: 0x263}, + 81: {From: 0x20f2, To: 0x22d}, + 82: {From: 0x20f9, To: 0x256}, + 83: {From: 0x210f, To: 0x21eb}, + 84: {From: 0x2135, To: 0x27d}, + 85: {From: 0x2160, To: 0x913}, + 86: {From: 0x2199, To: 0x121}, + 87: {From: 0x21ce, To: 0x1561}, + 88: {From: 0x21e6, To: 0x504}, + 89: {From: 0x21f4, To: 0x49f}, + 90: {From: 0x222d, To: 0x121}, + 91: {From: 0x2237, To: 0x121}, + 92: {From: 0x2262, To: 0x92a}, + 93: {From: 0x2316, To: 0x3226}, + 94: {From: 0x2382, To: 0x3365}, + 95: {From: 0x2472, To: 0x2c7}, + 96: {From: 0x24e4, To: 0x2ff}, + 97: {From: 0x24f0, To: 0x2fa}, + 98: {From: 0x24fa, To: 0x31f}, + 99: {From: 0x2550, To: 0xb5b}, + 100: {From: 0x25a9, To: 0xe2}, + 101: {From: 0x263e, To: 0x2d0}, + 102: {From: 0x26c9, To: 0x26b4}, + 103: {From: 0x26f9, To: 0x3c8}, + 104: {From: 0x2727, To: 0x3caf}, + 105: {From: 0x2765, To: 0x26b4}, + 106: {From: 0x2789, To: 0x4358}, + 107: {From: 0x28ef, To: 0x2837}, + 108: {From: 0x2914, To: 0x351}, + 109: {From: 0x2986, To: 0x2da7}, + 110: {From: 0x2b1a, To: 0x38d}, + 111: {From: 0x2bfc, To: 0x395}, + 112: {From: 0x2c3f, To: 0x3caf}, + 113: {From: 0x2cfc, To: 0x3be}, + 114: {From: 0x2d13, To: 0x597}, + 115: {From: 0x2d47, To: 0x148}, + 116: {From: 0x2d48, To: 0x148}, + 117: {From: 0x2dff, To: 0x2f1}, + 118: {From: 0x2e08, To: 0x19cc}, + 119: {From: 0x2e1a, To: 0x2d95}, + 120: {From: 0x2e21, To: 0x292}, + 121: {From: 0x2e54, To: 0x7d}, + 122: {From: 0x2e65, To: 0x2282}, + 123: {From: 0x2ea0, To: 0x2e9b}, + 124: {From: 0x2eef, To: 0x2ed7}, + 125: {From: 0x3193, To: 0x3c4}, + 126: {From: 0x3366, To: 0x338e}, + 127: {From: 0x342a, To: 0x3dc}, + 128: {From: 0x34ee, To: 0x18d0}, + 129: {From: 0x35c8, To: 0x2c9b}, + 130: {From: 0x35e6, To: 0x412}, + 131: {From: 0x3658, To: 0x246}, + 132: {From: 0x3676, To: 0x3f4}, + 133: {From: 0x36fd, To: 0x445}, + 134: {From: 0x37c0, To: 0x121}, + 135: {From: 0x3816, To: 0x38f2}, + 136: {From: 0x382b, To: 0x2c9b}, + 137: {From: 0x382f, To: 0xa9}, + 138: {From: 0x3832, To: 0x3228}, + 139: {From: 0x386c, To: 0x39a6}, + 140: {From: 0x3892, To: 0x3fc0}, + 141: {From: 0x38a5, To: 0x39d7}, + 142: {From: 0x38b4, To: 0x1fa4}, + 143: {From: 0x38b5, To: 0x2e9a}, + 144: {From: 0x395c, To: 0x47e}, + 145: {From: 0x3b4e, To: 0xd91}, + 146: {From: 0x3b78, To: 0x137}, + 147: {From: 0x3c99, To: 0x4bc}, + 148: {From: 0x3fbd, To: 0x100}, + 149: {From: 0x4208, To: 0xa91}, + 150: {From: 0x42be, To: 0x573}, + 151: {From: 0x42f9, To: 0x3f60}, + 152: {From: 0x4378, To: 0x25a}, + 153: {From: 0x43cb, To: 0x36cb}, + 154: {From: 0x43cd, To: 0x10f}, + 155: {From: 0x44af, To: 0x3322}, + 156: {From: 0x44e3, To: 0x512}, + 157: {From: 0x45ca, To: 0x2409}, + 158: {From: 0x45dd, To: 0x26dc}, + 159: {From: 0x4610, To: 0x48ae}, + 160: {From: 0x46ae, To: 0x46a0}, + 161: {From: 0x473e, To: 0x4745}, + 162: {From: 0x4916, To: 0x31f}, + 163: {From: 0x49a7, To: 0x523}, +} + +// Size: 164 bytes, 164 elements +var AliasTypes = [164]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, + // Entry 40 - 7F + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, + 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, + 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, + // Entry 80 - BF + 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, + 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, + 0, 1, 1, 1, +} + +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 976 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + + "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + + "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + + "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + + "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + + "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + + "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + + "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + + "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + + "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + + "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + + "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + + "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, + // Entry 140 - 17F + 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 480 - 4BF + 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 1615 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x4d, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x4f, + "aluku": 0x7, + "ao1990": 0x8, + "arevela": 0x9, + "arevmda": 0xa, + "asante": 0xb, + "baku1926": 0xc, + "balanka": 0xd, + "barla": 0xe, + "basiceng": 0xf, + "bauddha": 0x10, + "biscayan": 0x11, + "biske": 0x48, + "bohoric": 0x12, + "boont": 0x13, + "colb1945": 0x14, + "cornu": 0x15, + "dajnko": 0x16, + "ekavsk": 0x17, + "emodeng": 0x18, + "fonipa": 0x50, + "fonnapa": 0x51, + "fonupa": 0x52, + "fonxsamp": 0x53, + "hepburn": 0x19, + "heploc": 0x4e, + "hognorsk": 0x1a, + "hsistemo": 0x1b, + "ijekavsk": 0x1c, + "itihasa": 0x1d, + "jauer": 0x1e, + "jyutping": 0x1f, + "kkcor": 0x20, + "kociewie": 0x21, + "kscor": 0x22, + "laukika": 0x23, + "lipaw": 0x49, + "luna1918": 0x24, + "metelko": 0x25, + "monoton": 0x26, + "ndyuka": 0x27, + "nedis": 0x28, + "newfound": 0x29, + "njiva": 0x4a, + "nulik": 0x2a, + "osojs": 0x4b, + "oxendict": 0x2b, + "pahawh2": 0x2c, + "pahawh3": 0x2d, + "pahawh4": 0x2e, + "pamaka": 0x2f, + "petr1708": 0x30, + "pinyin": 0x31, + "polyton": 0x32, + "puter": 0x33, + "rigik": 0x34, + "rozaj": 0x35, + "rumgr": 0x36, + "scotland": 0x37, + "scouse": 0x38, + "simple": 0x54, + "solba": 0x4c, + "sotav": 0x39, + "spanglis": 0x3a, + "surmiran": 0x3b, + "sursilv": 0x3c, + "sutsilv": 0x3d, + "tarask": 0x3e, + "uccor": 0x3f, + "ucrcor": 0x40, + "ulster": 0x41, + "unifon": 0x42, + "vaidika": 0x43, + "valencia": 0x44, + "vallader": 0x45, + "wadegile": 0x46, + "xsistemo": 0x47, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 79 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 976 bytes, 244 elements +var likelyScript = [244]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 28: {lang: 0xf1, region: 0x6b}, + 30: {lang: 0x1a0, region: 0x5d}, + 31: {lang: 0x3e2, region: 0x106}, + 33: {lang: 0x1be, region: 0x99}, + 36: {lang: 0x15e, region: 0x78}, + 39: {lang: 0x133, region: 0x6b}, + 40: {lang: 0x431, region: 0x27}, + 41: {lang: 0x27, region: 0x6f}, + 43: {lang: 0x210, region: 0x7d}, + 44: {lang: 0xfe, region: 0x38}, + 46: {lang: 0x19b, region: 0x99}, + 47: {lang: 0x19e, region: 0x130}, + 48: {lang: 0x3e9, region: 0x99}, + 49: {lang: 0x136, region: 0x87}, + 50: {lang: 0x1a4, region: 0x99}, + 51: {lang: 0x39d, region: 0x99}, + 52: {lang: 0x529, region: 0x12e}, + 53: {lang: 0x254, region: 0xab}, + 54: {lang: 0x529, region: 0x53}, + 55: {lang: 0x1cb, region: 0xe7}, + 56: {lang: 0x529, region: 0x53}, + 57: {lang: 0x529, region: 0x12e}, + 58: {lang: 0x2fd, region: 0x9b}, + 59: {lang: 0x1bc, region: 0x97}, + 60: {lang: 0x200, region: 0xa2}, + 61: {lang: 0x1c5, region: 0x12b}, + 62: {lang: 0x1ca, region: 0xaf}, + 65: {lang: 0x1d5, region: 0x92}, + 67: {lang: 0x142, region: 0x9e}, + 68: {lang: 0x254, region: 0xab}, + 69: {lang: 0x20e, region: 0x95}, + 70: {lang: 0x200, region: 0xa2}, + 72: {lang: 0x135, region: 0xc4}, + 73: {lang: 0x200, region: 0xa2}, + 74: {lang: 0x3bb, region: 0xe8}, + 75: {lang: 0x24a, region: 0xa6}, + 76: {lang: 0x3fa, region: 0x99}, + 79: {lang: 0x251, region: 0x99}, + 80: {lang: 0x254, region: 0xab}, + 82: {lang: 0x88, region: 0x99}, + 83: {lang: 0x370, region: 0x123}, + 84: {lang: 0x2b8, region: 0xaf}, + 89: {lang: 0x29f, region: 0x99}, + 90: {lang: 0x2a8, region: 0x99}, + 91: {lang: 0x28f, region: 0x87}, + 92: {lang: 0x1a0, region: 0x87}, + 93: {lang: 0x2ac, region: 0x53}, + 95: {lang: 0x4f4, region: 0x12b}, + 96: {lang: 0x4f5, region: 0x12b}, + 97: {lang: 0x1be, region: 0x99}, + 99: {lang: 0x337, region: 0x9c}, + 100: {lang: 0x4f7, region: 0x53}, + 101: {lang: 0xa9, region: 0x53}, + 104: {lang: 0x2e8, region: 0x112}, + 105: {lang: 0x4f8, region: 0x10b}, + 106: {lang: 0x4f8, region: 0x10b}, + 107: {lang: 0x304, region: 0x99}, + 108: {lang: 0x31b, region: 0x99}, + 109: {lang: 0x30b, region: 0x53}, + 111: {lang: 0x31e, region: 0x35}, + 112: {lang: 0x30e, region: 0x99}, + 113: {lang: 0x414, region: 0xe8}, + 114: {lang: 0x331, region: 0xc4}, + 115: {lang: 0x4f9, region: 0x108}, + 116: {lang: 0x3b, region: 0xa1}, + 117: {lang: 0x353, region: 0xdb}, + 120: {lang: 0x2d0, region: 0x84}, + 121: {lang: 0x52a, region: 0x53}, + 122: {lang: 0x403, region: 0x96}, + 123: {lang: 0x3ee, region: 0x99}, + 124: {lang: 0x39b, region: 0xc5}, + 125: {lang: 0x395, region: 0x99}, + 126: {lang: 0x399, region: 0x135}, + 127: {lang: 0x429, region: 0x115}, + 128: {lang: 0x3b, region: 0x11c}, + 129: {lang: 0xfd, region: 0xc4}, + 130: {lang: 0x27d, region: 0x106}, + 131: {lang: 0x2c9, region: 0x53}, + 132: {lang: 0x39f, region: 0x9c}, + 133: {lang: 0x39f, region: 0x53}, + 135: {lang: 0x3ad, region: 0xb0}, + 137: {lang: 0x1c6, region: 0x53}, + 138: {lang: 0x4fd, region: 0x9c}, + 189: {lang: 0x3cb, region: 0x95}, + 191: {lang: 0x372, region: 0x10c}, + 192: {lang: 0x420, region: 0x97}, + 194: {lang: 0x4ff, region: 0x15e}, + 195: {lang: 0x3f0, region: 0x99}, + 196: {lang: 0x45, region: 0x135}, + 197: {lang: 0x139, region: 0x7b}, + 198: {lang: 0x3e9, region: 0x99}, + 200: {lang: 0x3e9, region: 0x99}, + 201: {lang: 0x3fa, region: 0x99}, + 202: {lang: 0x40c, region: 0xb3}, + 203: {lang: 0x433, region: 0x99}, + 204: {lang: 0xef, region: 0xc5}, + 205: {lang: 0x43e, region: 0x95}, + 206: {lang: 0x44d, region: 0x35}, + 207: {lang: 0x44e, region: 0x9b}, + 211: {lang: 0x45a, region: 0xe7}, + 212: {lang: 0x11a, region: 0x99}, + 213: {lang: 0x45e, region: 0x53}, + 214: {lang: 0x232, region: 0x53}, + 215: {lang: 0x450, region: 0x99}, + 216: {lang: 0x4a5, region: 0x53}, + 217: {lang: 0x9f, region: 0x13e}, + 218: {lang: 0x461, region: 0x99}, + 220: {lang: 0x528, region: 0xba}, + 221: {lang: 0x153, region: 0xe7}, + 222: {lang: 0x128, region: 0xcd}, + 223: {lang: 0x46b, region: 0x123}, + 224: {lang: 0xa9, region: 0x53}, + 225: {lang: 0x2ce, region: 0x99}, + 226: {lang: 0x4ad, region: 0x11c}, + 227: {lang: 0x4be, region: 0xb4}, + 229: {lang: 0x1ce, region: 0x99}, + 232: {lang: 0x3a9, region: 0x9c}, + 233: {lang: 0x22, region: 0x9b}, + 234: {lang: 0x1ea, region: 0x53}, + 235: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 5320 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x57, flags: 0x0}, + 1: {region: 0x6f, script: 0x57, flags: 0x0}, + 2: {region: 0x165, script: 0x57, flags: 0x0}, + 3: {region: 0x165, script: 0x57, flags: 0x0}, + 4: {region: 0x165, script: 0x57, flags: 0x0}, + 5: {region: 0x7d, script: 0x1f, flags: 0x0}, + 6: {region: 0x165, script: 0x57, flags: 0x0}, + 7: {region: 0x165, script: 0x1f, flags: 0x0}, + 8: {region: 0x80, script: 0x57, flags: 0x0}, + 9: {region: 0x165, script: 0x57, flags: 0x0}, + 10: {region: 0x165, script: 0x57, flags: 0x0}, + 11: {region: 0x165, script: 0x57, flags: 0x0}, + 12: {region: 0x95, script: 0x57, flags: 0x0}, + 13: {region: 0x131, script: 0x57, flags: 0x0}, + 14: {region: 0x80, script: 0x57, flags: 0x0}, + 15: {region: 0x165, script: 0x57, flags: 0x0}, + 16: {region: 0x165, script: 0x57, flags: 0x0}, + 17: {region: 0x106, script: 0x1f, flags: 0x0}, + 18: {region: 0x165, script: 0x57, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x57, flags: 0x0}, + 22: {region: 0x161, script: 0x57, flags: 0x0}, + 23: {region: 0x165, script: 0x57, flags: 0x0}, + 24: {region: 0x165, script: 0x57, flags: 0x0}, + 25: {region: 0x165, script: 0x57, flags: 0x0}, + 26: {region: 0x165, script: 0x57, flags: 0x0}, + 27: {region: 0x165, script: 0x57, flags: 0x0}, + 28: {region: 0x52, script: 0x57, flags: 0x0}, + 29: {region: 0x165, script: 0x57, flags: 0x0}, + 30: {region: 0x165, script: 0x57, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x57, flags: 0x0}, + 33: {region: 0x80, script: 0x57, flags: 0x0}, + 34: {region: 0x9b, script: 0xe9, flags: 0x0}, + 35: {region: 0x165, script: 0x57, flags: 0x0}, + 36: {region: 0x165, script: 0x57, flags: 0x0}, + 37: {region: 0x14d, script: 0x57, flags: 0x0}, + 38: {region: 0x106, script: 0x1f, flags: 0x0}, + 39: {region: 0x6f, script: 0x29, flags: 0x0}, + 40: {region: 0x165, script: 0x57, flags: 0x0}, + 41: {region: 0x165, script: 0x57, flags: 0x0}, + 42: {region: 0xd6, script: 0x57, flags: 0x0}, + 43: {region: 0x165, script: 0x57, flags: 0x0}, + 45: {region: 0x165, script: 0x57, flags: 0x0}, + 46: {region: 0x165, script: 0x57, flags: 0x0}, + 47: {region: 0x165, script: 0x57, flags: 0x0}, + 48: {region: 0x165, script: 0x57, flags: 0x0}, + 49: {region: 0x165, script: 0x57, flags: 0x0}, + 50: {region: 0x165, script: 0x57, flags: 0x0}, + 51: {region: 0x95, script: 0x57, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x57, flags: 0x0}, + 55: {region: 0x165, script: 0x57, flags: 0x0}, + 56: {region: 0x165, script: 0x57, flags: 0x0}, + 57: {region: 0x165, script: 0x57, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x57, flags: 0x0}, + 61: {region: 0x51, script: 0x57, flags: 0x0}, + 62: {region: 0x3f, script: 0x57, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x57, flags: 0x0}, + 69: {region: 0x135, script: 0xc4, flags: 0x0}, + 70: {region: 0x165, script: 0x57, flags: 0x0}, + 71: {region: 0x165, script: 0x57, flags: 0x0}, + 72: {region: 0x6e, script: 0x57, flags: 0x0}, + 73: {region: 0x165, script: 0x57, flags: 0x0}, + 74: {region: 0x165, script: 0x57, flags: 0x0}, + 75: {region: 0x49, script: 0x57, flags: 0x0}, + 76: {region: 0x165, script: 0x57, flags: 0x0}, + 77: {region: 0x106, script: 0x1f, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x57, flags: 0x0}, + 80: {region: 0x165, script: 0x57, flags: 0x0}, + 81: {region: 0x165, script: 0x57, flags: 0x0}, + 82: {region: 0x99, script: 0x21, flags: 0x0}, + 83: {region: 0x165, script: 0x57, flags: 0x0}, + 84: {region: 0x165, script: 0x57, flags: 0x0}, + 85: {region: 0x165, script: 0x57, flags: 0x0}, + 86: {region: 0x3f, script: 0x57, flags: 0x0}, + 87: {region: 0x165, script: 0x57, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x1f, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x57, flags: 0x0}, + 92: {region: 0xdb, script: 0x21, flags: 0x0}, + 93: {region: 0x2e, script: 0x57, flags: 0x0}, + 94: {region: 0x52, script: 0x57, flags: 0x0}, + 95: {region: 0x165, script: 0x57, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x57, flags: 0x0}, + 98: {region: 0x165, script: 0x57, flags: 0x0}, + 99: {region: 0x95, script: 0x57, flags: 0x0}, + 100: {region: 0x165, script: 0x57, flags: 0x0}, + 101: {region: 0x52, script: 0x57, flags: 0x0}, + 102: {region: 0x165, script: 0x57, flags: 0x0}, + 103: {region: 0x165, script: 0x57, flags: 0x0}, + 104: {region: 0x165, script: 0x57, flags: 0x0}, + 105: {region: 0x165, script: 0x57, flags: 0x0}, + 106: {region: 0x4f, script: 0x57, flags: 0x0}, + 107: {region: 0x165, script: 0x57, flags: 0x0}, + 108: {region: 0x165, script: 0x57, flags: 0x0}, + 109: {region: 0x165, script: 0x57, flags: 0x0}, + 110: {region: 0x165, script: 0x29, flags: 0x0}, + 111: {region: 0x165, script: 0x57, flags: 0x0}, + 112: {region: 0x165, script: 0x57, flags: 0x0}, + 113: {region: 0x47, script: 0x1f, flags: 0x0}, + 114: {region: 0x165, script: 0x57, flags: 0x0}, + 115: {region: 0x165, script: 0x57, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x57, flags: 0x0}, + 118: {region: 0x165, script: 0x57, flags: 0x0}, + 119: {region: 0x95, script: 0x57, flags: 0x0}, + 120: {region: 0x165, script: 0x57, flags: 0x0}, + 121: {region: 0x12f, script: 0x57, flags: 0x0}, + 122: {region: 0x52, script: 0x57, flags: 0x0}, + 123: {region: 0x99, script: 0xd7, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x21, flags: 0x0}, + 126: {region: 0x38, script: 0x1f, flags: 0x0}, + 127: {region: 0x99, script: 0x21, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x31, flags: 0x0}, + 131: {region: 0x99, script: 0x21, flags: 0x0}, + 132: {region: 0x165, script: 0x57, flags: 0x0}, + 133: {region: 0x99, script: 0x21, flags: 0x0}, + 134: {region: 0xe7, script: 0x57, flags: 0x0}, + 135: {region: 0x165, script: 0x57, flags: 0x0}, + 136: {region: 0x99, script: 0x21, flags: 0x0}, + 137: {region: 0x165, script: 0x57, flags: 0x0}, + 138: {region: 0x13f, script: 0x57, flags: 0x0}, + 139: {region: 0x165, script: 0x57, flags: 0x0}, + 140: {region: 0x165, script: 0x57, flags: 0x0}, + 141: {region: 0xe7, script: 0x57, flags: 0x0}, + 142: {region: 0x165, script: 0x57, flags: 0x0}, + 143: {region: 0xd6, script: 0x57, flags: 0x0}, + 144: {region: 0x165, script: 0x57, flags: 0x0}, + 145: {region: 0x165, script: 0x57, flags: 0x0}, + 146: {region: 0x165, script: 0x57, flags: 0x0}, + 147: {region: 0x165, script: 0x29, flags: 0x0}, + 148: {region: 0x99, script: 0x21, flags: 0x0}, + 149: {region: 0x95, script: 0x57, flags: 0x0}, + 150: {region: 0x165, script: 0x57, flags: 0x0}, + 151: {region: 0x165, script: 0x57, flags: 0x0}, + 152: {region: 0x114, script: 0x57, flags: 0x0}, + 153: {region: 0x165, script: 0x57, flags: 0x0}, + 154: {region: 0x165, script: 0x57, flags: 0x0}, + 155: {region: 0x52, script: 0x57, flags: 0x0}, + 156: {region: 0x165, script: 0x57, flags: 0x0}, + 157: {region: 0xe7, script: 0x57, flags: 0x0}, + 158: {region: 0x165, script: 0x57, flags: 0x0}, + 159: {region: 0x13e, script: 0xd9, flags: 0x0}, + 160: {region: 0xc3, script: 0x57, flags: 0x0}, + 161: {region: 0x165, script: 0x57, flags: 0x0}, + 162: {region: 0x165, script: 0x57, flags: 0x0}, + 163: {region: 0xc3, script: 0x57, flags: 0x0}, + 164: {region: 0x165, script: 0x57, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x57, flags: 0x0}, + 167: {region: 0x165, script: 0x57, flags: 0x0}, + 168: {region: 0x165, script: 0x57, flags: 0x0}, + 169: {region: 0x53, script: 0xe0, flags: 0x0}, + 170: {region: 0x165, script: 0x57, flags: 0x0}, + 171: {region: 0x165, script: 0x57, flags: 0x0}, + 172: {region: 0x165, script: 0x57, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x57, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x57, flags: 0x0}, + 177: {region: 0x4f, script: 0x57, flags: 0x0}, + 178: {region: 0x78, script: 0x57, flags: 0x0}, + 179: {region: 0x99, script: 0x21, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x21, flags: 0x0}, + 182: {region: 0x165, script: 0x57, flags: 0x0}, + 183: {region: 0x33, script: 0x57, flags: 0x0}, + 184: {region: 0x165, script: 0x57, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x57, flags: 0x0}, + 187: {region: 0x165, script: 0x29, flags: 0x0}, + 188: {region: 0xe7, script: 0x57, flags: 0x0}, + 189: {region: 0x165, script: 0x57, flags: 0x0}, + 190: {region: 0xe8, script: 0x21, flags: 0x0}, + 191: {region: 0x106, script: 0x1f, flags: 0x0}, + 192: {region: 0x15f, script: 0x57, flags: 0x0}, + 193: {region: 0x165, script: 0x57, flags: 0x0}, + 194: {region: 0x95, script: 0x57, flags: 0x0}, + 195: {region: 0x165, script: 0x57, flags: 0x0}, + 196: {region: 0x52, script: 0x57, flags: 0x0}, + 197: {region: 0x165, script: 0x57, flags: 0x0}, + 198: {region: 0x165, script: 0x57, flags: 0x0}, + 199: {region: 0x165, script: 0x57, flags: 0x0}, + 200: {region: 0x86, script: 0x57, flags: 0x0}, + 201: {region: 0x165, script: 0x57, flags: 0x0}, + 202: {region: 0x165, script: 0x57, flags: 0x0}, + 203: {region: 0x165, script: 0x57, flags: 0x0}, + 204: {region: 0x165, script: 0x57, flags: 0x0}, + 205: {region: 0x6d, script: 0x29, flags: 0x0}, + 206: {region: 0x165, script: 0x57, flags: 0x0}, + 207: {region: 0x165, script: 0x57, flags: 0x0}, + 208: {region: 0x52, script: 0x57, flags: 0x0}, + 209: {region: 0x165, script: 0x57, flags: 0x0}, + 210: {region: 0x165, script: 0x57, flags: 0x0}, + 211: {region: 0xc3, script: 0x57, flags: 0x0}, + 212: {region: 0x165, script: 0x57, flags: 0x0}, + 213: {region: 0x165, script: 0x57, flags: 0x0}, + 214: {region: 0x165, script: 0x57, flags: 0x0}, + 215: {region: 0x6e, script: 0x57, flags: 0x0}, + 216: {region: 0x165, script: 0x57, flags: 0x0}, + 217: {region: 0x165, script: 0x57, flags: 0x0}, + 218: {region: 0xd6, script: 0x57, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x1f, flags: 0x0}, + 221: {region: 0xe7, script: 0x57, flags: 0x0}, + 222: {region: 0x165, script: 0x57, flags: 0x0}, + 223: {region: 0x131, script: 0x57, flags: 0x0}, + 224: {region: 0x8a, script: 0x57, flags: 0x0}, + 225: {region: 0x75, script: 0x57, flags: 0x0}, + 226: {region: 0x106, script: 0x1f, flags: 0x0}, + 227: {region: 0x135, script: 0x57, flags: 0x0}, + 228: {region: 0x49, script: 0x57, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x57, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x57, flags: 0x0}, + 235: {region: 0x165, script: 0x57, flags: 0x0}, + 236: {region: 0x165, script: 0x57, flags: 0x0}, + 237: {region: 0x165, script: 0x57, flags: 0x0}, + 238: {region: 0x165, script: 0x57, flags: 0x0}, + 239: {region: 0xc5, script: 0xcc, flags: 0x0}, + 240: {region: 0x78, script: 0x57, flags: 0x0}, + 241: {region: 0x6b, script: 0x1c, flags: 0x0}, + 242: {region: 0xe7, script: 0x57, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x1f, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x57, flags: 0x0}, + 250: {region: 0x5e, script: 0x57, flags: 0x0}, + 251: {region: 0xe9, script: 0x57, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x81, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x1f, flags: 0x0}, + 256: {region: 0x7b, script: 0x57, flags: 0x0}, + 257: {region: 0x63, script: 0x57, flags: 0x0}, + 258: {region: 0x165, script: 0x57, flags: 0x0}, + 259: {region: 0x165, script: 0x57, flags: 0x0}, + 260: {region: 0x165, script: 0x57, flags: 0x0}, + 261: {region: 0x165, script: 0x57, flags: 0x0}, + 262: {region: 0x135, script: 0x57, flags: 0x0}, + 263: {region: 0x106, script: 0x1f, flags: 0x0}, + 264: {region: 0xa4, script: 0x57, flags: 0x0}, + 265: {region: 0x165, script: 0x57, flags: 0x0}, + 266: {region: 0x165, script: 0x57, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x57, flags: 0x0}, + 269: {region: 0x60, script: 0x57, flags: 0x0}, + 270: {region: 0x165, script: 0x57, flags: 0x0}, + 271: {region: 0x49, script: 0x57, flags: 0x0}, + 272: {region: 0x165, script: 0x57, flags: 0x0}, + 273: {region: 0x165, script: 0x57, flags: 0x0}, + 274: {region: 0x165, script: 0x57, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x57, flags: 0x0}, + 277: {region: 0x165, script: 0x57, flags: 0x0}, + 278: {region: 0x165, script: 0x57, flags: 0x0}, + 279: {region: 0xd4, script: 0x57, flags: 0x0}, + 280: {region: 0x4f, script: 0x57, flags: 0x0}, + 281: {region: 0x165, script: 0x57, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x57, flags: 0x0}, + 284: {region: 0x165, script: 0x57, flags: 0x0}, + 285: {region: 0x165, script: 0x57, flags: 0x0}, + 286: {region: 0x165, script: 0x29, flags: 0x0}, + 287: {region: 0x60, script: 0x57, flags: 0x0}, + 288: {region: 0xc3, script: 0x57, flags: 0x0}, + 289: {region: 0xd0, script: 0x57, flags: 0x0}, + 290: {region: 0x165, script: 0x57, flags: 0x0}, + 291: {region: 0xdb, script: 0x21, flags: 0x0}, + 292: {region: 0x52, script: 0x57, flags: 0x0}, + 293: {region: 0x165, script: 0x57, flags: 0x0}, + 294: {region: 0x165, script: 0x57, flags: 0x0}, + 295: {region: 0x165, script: 0x57, flags: 0x0}, + 296: {region: 0xcd, script: 0xde, flags: 0x0}, + 297: {region: 0x165, script: 0x57, flags: 0x0}, + 298: {region: 0x165, script: 0x57, flags: 0x0}, + 299: {region: 0x114, script: 0x57, flags: 0x0}, + 300: {region: 0x37, script: 0x57, flags: 0x0}, + 301: {region: 0x43, script: 0xe0, flags: 0x0}, + 302: {region: 0x165, script: 0x57, flags: 0x0}, + 303: {region: 0xa4, script: 0x57, flags: 0x0}, + 304: {region: 0x80, script: 0x57, flags: 0x0}, + 305: {region: 0xd6, script: 0x57, flags: 0x0}, + 306: {region: 0x9e, script: 0x57, flags: 0x0}, + 307: {region: 0x6b, script: 0x27, flags: 0x0}, + 308: {region: 0x165, script: 0x57, flags: 0x0}, + 309: {region: 0xc4, script: 0x48, flags: 0x0}, + 310: {region: 0x87, script: 0x31, flags: 0x0}, + 311: {region: 0x165, script: 0x57, flags: 0x0}, + 312: {region: 0x165, script: 0x57, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x57, flags: 0x0}, + 315: {region: 0x165, script: 0x57, flags: 0x0}, + 316: {region: 0x1, script: 0x57, flags: 0x0}, + 317: {region: 0x165, script: 0x57, flags: 0x0}, + 318: {region: 0x6e, script: 0x57, flags: 0x0}, + 319: {region: 0x135, script: 0x57, flags: 0x0}, + 320: {region: 0x6a, script: 0x57, flags: 0x0}, + 321: {region: 0x165, script: 0x57, flags: 0x0}, + 322: {region: 0x9e, script: 0x43, flags: 0x0}, + 323: {region: 0x165, script: 0x57, flags: 0x0}, + 324: {region: 0x165, script: 0x57, flags: 0x0}, + 325: {region: 0x6e, script: 0x57, flags: 0x0}, + 326: {region: 0x52, script: 0x57, flags: 0x0}, + 327: {region: 0x6e, script: 0x57, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x57, flags: 0x0}, + 330: {region: 0x165, script: 0x57, flags: 0x0}, + 331: {region: 0x165, script: 0x57, flags: 0x0}, + 332: {region: 0x165, script: 0x57, flags: 0x0}, + 333: {region: 0x86, script: 0x57, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x57, flags: 0x0}, + 336: {region: 0xc3, script: 0x57, flags: 0x0}, + 337: {region: 0x72, script: 0x57, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x57, flags: 0x0}, + 340: {region: 0x10c, script: 0x57, flags: 0x0}, + 341: {region: 0x73, script: 0x57, flags: 0x0}, + 342: {region: 0x165, script: 0x57, flags: 0x0}, + 343: {region: 0x165, script: 0x57, flags: 0x0}, + 344: {region: 0x76, script: 0x57, flags: 0x0}, + 345: {region: 0x165, script: 0x57, flags: 0x0}, + 346: {region: 0x3b, script: 0x57, flags: 0x0}, + 347: {region: 0x165, script: 0x57, flags: 0x0}, + 348: {region: 0x165, script: 0x57, flags: 0x0}, + 349: {region: 0x165, script: 0x57, flags: 0x0}, + 350: {region: 0x78, script: 0x57, flags: 0x0}, + 351: {region: 0x135, script: 0x57, flags: 0x0}, + 352: {region: 0x78, script: 0x57, flags: 0x0}, + 353: {region: 0x60, script: 0x57, flags: 0x0}, + 354: {region: 0x60, script: 0x57, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x57, flags: 0x0}, + 357: {region: 0x165, script: 0x57, flags: 0x0}, + 358: {region: 0x84, script: 0x57, flags: 0x0}, + 359: {region: 0x165, script: 0x57, flags: 0x0}, + 360: {region: 0xd4, script: 0x57, flags: 0x0}, + 361: {region: 0x9e, script: 0x57, flags: 0x0}, + 362: {region: 0xd6, script: 0x57, flags: 0x0}, + 363: {region: 0x165, script: 0x57, flags: 0x0}, + 364: {region: 0x10b, script: 0x57, flags: 0x0}, + 365: {region: 0xd9, script: 0x57, flags: 0x0}, + 366: {region: 0x96, script: 0x57, flags: 0x0}, + 367: {region: 0x80, script: 0x57, flags: 0x0}, + 368: {region: 0x165, script: 0x57, flags: 0x0}, + 369: {region: 0xbc, script: 0x57, flags: 0x0}, + 370: {region: 0x165, script: 0x57, flags: 0x0}, + 371: {region: 0x165, script: 0x57, flags: 0x0}, + 372: {region: 0x165, script: 0x57, flags: 0x0}, + 373: {region: 0x53, script: 0x38, flags: 0x0}, + 374: {region: 0x165, script: 0x57, flags: 0x0}, + 375: {region: 0x95, script: 0x57, flags: 0x0}, + 376: {region: 0x165, script: 0x57, flags: 0x0}, + 377: {region: 0x165, script: 0x57, flags: 0x0}, + 378: {region: 0x99, script: 0x21, flags: 0x0}, + 379: {region: 0x165, script: 0x57, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x57, flags: 0x0}, + 382: {region: 0x7b, script: 0x57, flags: 0x0}, + 383: {region: 0x165, script: 0x57, flags: 0x0}, + 384: {region: 0x165, script: 0x57, flags: 0x0}, + 385: {region: 0x165, script: 0x57, flags: 0x0}, + 386: {region: 0x165, script: 0x57, flags: 0x0}, + 387: {region: 0x165, script: 0x57, flags: 0x0}, + 388: {region: 0x165, script: 0x57, flags: 0x0}, + 389: {region: 0x6f, script: 0x29, flags: 0x0}, + 390: {region: 0x165, script: 0x57, flags: 0x0}, + 391: {region: 0xdb, script: 0x21, flags: 0x0}, + 392: {region: 0x165, script: 0x57, flags: 0x0}, + 393: {region: 0xa7, script: 0x57, flags: 0x0}, + 394: {region: 0x165, script: 0x57, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x57, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x57, flags: 0x0}, + 399: {region: 0x165, script: 0x57, flags: 0x0}, + 400: {region: 0x6e, script: 0x57, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x57, flags: 0x0}, + 403: {region: 0x165, script: 0x29, flags: 0x0}, + 404: {region: 0xf1, script: 0x57, flags: 0x0}, + 405: {region: 0x165, script: 0x57, flags: 0x0}, + 406: {region: 0x165, script: 0x57, flags: 0x0}, + 407: {region: 0x165, script: 0x57, flags: 0x0}, + 408: {region: 0x165, script: 0x29, flags: 0x0}, + 409: {region: 0x165, script: 0x57, flags: 0x0}, + 410: {region: 0x99, script: 0x21, flags: 0x0}, + 411: {region: 0x99, script: 0xda, flags: 0x0}, + 412: {region: 0x95, script: 0x57, flags: 0x0}, + 413: {region: 0xd9, script: 0x57, flags: 0x0}, + 414: {region: 0x130, script: 0x2f, flags: 0x0}, + 415: {region: 0x165, script: 0x57, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x57, flags: 0x0}, + 419: {region: 0x4e, script: 0x57, flags: 0x0}, + 420: {region: 0x99, script: 0x32, flags: 0x0}, + 421: {region: 0x41, script: 0x57, flags: 0x0}, + 422: {region: 0x54, script: 0x57, flags: 0x0}, + 423: {region: 0x165, script: 0x57, flags: 0x0}, + 424: {region: 0x80, script: 0x57, flags: 0x0}, + 425: {region: 0x165, script: 0x57, flags: 0x0}, + 426: {region: 0x165, script: 0x57, flags: 0x0}, + 427: {region: 0xa4, script: 0x57, flags: 0x0}, + 428: {region: 0x98, script: 0x57, flags: 0x0}, + 429: {region: 0x165, script: 0x57, flags: 0x0}, + 430: {region: 0xdb, script: 0x21, flags: 0x0}, + 431: {region: 0x165, script: 0x57, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x57, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x57, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x57, flags: 0x0}, + 438: {region: 0x53, script: 0x38, flags: 0x0}, + 439: {region: 0x165, script: 0x57, flags: 0x0}, + 440: {region: 0x135, script: 0x57, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x57, flags: 0x0}, + 443: {region: 0x165, script: 0x29, flags: 0x0}, + 444: {region: 0x97, script: 0x3b, flags: 0x0}, + 445: {region: 0x165, script: 0x57, flags: 0x0}, + 446: {region: 0x99, script: 0x21, flags: 0x0}, + 447: {region: 0x165, script: 0x57, flags: 0x0}, + 448: {region: 0x73, script: 0x57, flags: 0x0}, + 449: {region: 0x165, script: 0x57, flags: 0x0}, + 450: {region: 0x165, script: 0x57, flags: 0x0}, + 451: {region: 0xe7, script: 0x57, flags: 0x0}, + 452: {region: 0x165, script: 0x57, flags: 0x0}, + 453: {region: 0x12b, script: 0x3d, flags: 0x0}, + 454: {region: 0x53, script: 0x89, flags: 0x0}, + 455: {region: 0x165, script: 0x57, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x21, flags: 0x0}, + 458: {region: 0xaf, script: 0x3e, flags: 0x0}, + 459: {region: 0xe7, script: 0x57, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x57, flags: 0x0}, + 462: {region: 0x99, script: 0x21, flags: 0x0}, + 463: {region: 0x99, script: 0x21, flags: 0x0}, + 464: {region: 0x165, script: 0x57, flags: 0x0}, + 465: {region: 0x90, script: 0x57, flags: 0x0}, + 466: {region: 0x60, script: 0x57, flags: 0x0}, + 467: {region: 0x53, script: 0x38, flags: 0x0}, + 468: {region: 0x91, script: 0x57, flags: 0x0}, + 469: {region: 0x92, script: 0x57, flags: 0x0}, + 470: {region: 0x165, script: 0x57, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x57, flags: 0x0}, + 473: {region: 0x78, script: 0x57, flags: 0x0}, + 474: {region: 0x165, script: 0x57, flags: 0x0}, + 475: {region: 0x165, script: 0x57, flags: 0x0}, + 476: {region: 0xd0, script: 0x57, flags: 0x0}, + 477: {region: 0xd6, script: 0x57, flags: 0x0}, + 478: {region: 0x165, script: 0x57, flags: 0x0}, + 479: {region: 0x165, script: 0x57, flags: 0x0}, + 480: {region: 0x165, script: 0x57, flags: 0x0}, + 481: {region: 0x95, script: 0x57, flags: 0x0}, + 482: {region: 0x165, script: 0x57, flags: 0x0}, + 483: {region: 0x165, script: 0x57, flags: 0x0}, + 484: {region: 0x165, script: 0x57, flags: 0x0}, + 486: {region: 0x122, script: 0x57, flags: 0x0}, + 487: {region: 0xd6, script: 0x57, flags: 0x0}, + 488: {region: 0x165, script: 0x57, flags: 0x0}, + 489: {region: 0x165, script: 0x57, flags: 0x0}, + 490: {region: 0x53, script: 0xea, flags: 0x0}, + 491: {region: 0x165, script: 0x57, flags: 0x0}, + 492: {region: 0x135, script: 0x57, flags: 0x0}, + 493: {region: 0x165, script: 0x57, flags: 0x0}, + 494: {region: 0x49, script: 0x57, flags: 0x0}, + 495: {region: 0x165, script: 0x57, flags: 0x0}, + 496: {region: 0x165, script: 0x57, flags: 0x0}, + 497: {region: 0xe7, script: 0x57, flags: 0x0}, + 498: {region: 0x165, script: 0x57, flags: 0x0}, + 499: {region: 0x95, script: 0x57, flags: 0x0}, + 500: {region: 0x106, script: 0x1f, flags: 0x0}, + 501: {region: 0x1, script: 0x57, flags: 0x0}, + 502: {region: 0x165, script: 0x57, flags: 0x0}, + 503: {region: 0x165, script: 0x57, flags: 0x0}, + 504: {region: 0x9d, script: 0x57, flags: 0x0}, + 505: {region: 0x9e, script: 0x57, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3b, flags: 0x0}, + 508: {region: 0x165, script: 0x57, flags: 0x0}, + 509: {region: 0x165, script: 0x57, flags: 0x0}, + 510: {region: 0x106, script: 0x57, flags: 0x0}, + 511: {region: 0x165, script: 0x57, flags: 0x0}, + 512: {region: 0xa2, script: 0x46, flags: 0x0}, + 513: {region: 0x165, script: 0x57, flags: 0x0}, + 514: {region: 0xa0, script: 0x57, flags: 0x0}, + 515: {region: 0x1, script: 0x57, flags: 0x0}, + 516: {region: 0x165, script: 0x57, flags: 0x0}, + 517: {region: 0x165, script: 0x57, flags: 0x0}, + 518: {region: 0x165, script: 0x57, flags: 0x0}, + 519: {region: 0x52, script: 0x57, flags: 0x0}, + 520: {region: 0x130, script: 0x3b, flags: 0x0}, + 521: {region: 0x165, script: 0x57, flags: 0x0}, + 522: {region: 0x12f, script: 0x57, flags: 0x0}, + 523: {region: 0xdb, script: 0x21, flags: 0x0}, + 524: {region: 0x165, script: 0x57, flags: 0x0}, + 525: {region: 0x63, script: 0x57, flags: 0x0}, + 526: {region: 0x95, script: 0x57, flags: 0x0}, + 527: {region: 0x95, script: 0x57, flags: 0x0}, + 528: {region: 0x7d, script: 0x2b, flags: 0x0}, + 529: {region: 0x137, script: 0x1f, flags: 0x0}, + 530: {region: 0x67, script: 0x57, flags: 0x0}, + 531: {region: 0xc4, script: 0x57, flags: 0x0}, + 532: {region: 0x165, script: 0x57, flags: 0x0}, + 533: {region: 0x165, script: 0x57, flags: 0x0}, + 534: {region: 0xd6, script: 0x57, flags: 0x0}, + 535: {region: 0xa4, script: 0x57, flags: 0x0}, + 536: {region: 0xc3, script: 0x57, flags: 0x0}, + 537: {region: 0x106, script: 0x1f, flags: 0x0}, + 538: {region: 0x165, script: 0x57, flags: 0x0}, + 539: {region: 0x165, script: 0x57, flags: 0x0}, + 540: {region: 0x165, script: 0x57, flags: 0x0}, + 541: {region: 0x165, script: 0x57, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x57, flags: 0x0}, + 544: {region: 0x164, script: 0x57, flags: 0x0}, + 545: {region: 0x165, script: 0x57, flags: 0x0}, + 546: {region: 0x165, script: 0x57, flags: 0x0}, + 547: {region: 0x12f, script: 0x57, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x57, flags: 0x0}, + 550: {region: 0x123, script: 0xdf, flags: 0x0}, + 551: {region: 0x5a, script: 0x57, flags: 0x0}, + 552: {region: 0x52, script: 0x57, flags: 0x0}, + 553: {region: 0x165, script: 0x57, flags: 0x0}, + 554: {region: 0x4f, script: 0x57, flags: 0x0}, + 555: {region: 0x99, script: 0x21, flags: 0x0}, + 556: {region: 0x99, script: 0x21, flags: 0x0}, + 557: {region: 0x4b, script: 0x57, flags: 0x0}, + 558: {region: 0x95, script: 0x57, flags: 0x0}, + 559: {region: 0x165, script: 0x57, flags: 0x0}, + 560: {region: 0x41, script: 0x57, flags: 0x0}, + 561: {region: 0x99, script: 0x57, flags: 0x0}, + 562: {region: 0x53, script: 0xd6, flags: 0x0}, + 563: {region: 0x99, script: 0x21, flags: 0x0}, + 564: {region: 0xc3, script: 0x57, flags: 0x0}, + 565: {region: 0x165, script: 0x57, flags: 0x0}, + 566: {region: 0x99, script: 0x72, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x57, flags: 0x0}, + 569: {region: 0xa4, script: 0x57, flags: 0x0}, + 570: {region: 0x165, script: 0x57, flags: 0x0}, + 571: {region: 0x12b, script: 0x57, flags: 0x0}, + 572: {region: 0x165, script: 0x57, flags: 0x0}, + 573: {region: 0xd2, script: 0x57, flags: 0x0}, + 574: {region: 0x165, script: 0x57, flags: 0x0}, + 575: {region: 0xaf, script: 0x54, flags: 0x0}, + 576: {region: 0x165, script: 0x57, flags: 0x0}, + 577: {region: 0x165, script: 0x57, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x57, flags: 0x0}, + 580: {region: 0x52, script: 0x57, flags: 0x0}, + 581: {region: 0x82, script: 0x57, flags: 0x0}, + 582: {region: 0xa4, script: 0x57, flags: 0x0}, + 583: {region: 0x165, script: 0x57, flags: 0x0}, + 584: {region: 0x165, script: 0x57, flags: 0x0}, + 585: {region: 0x165, script: 0x57, flags: 0x0}, + 586: {region: 0xa6, script: 0x4b, flags: 0x0}, + 587: {region: 0x2a, script: 0x57, flags: 0x0}, + 588: {region: 0x165, script: 0x57, flags: 0x0}, + 589: {region: 0x165, script: 0x57, flags: 0x0}, + 590: {region: 0x165, script: 0x57, flags: 0x0}, + 591: {region: 0x165, script: 0x57, flags: 0x0}, + 592: {region: 0x165, script: 0x57, flags: 0x0}, + 593: {region: 0x99, script: 0x4f, flags: 0x0}, + 594: {region: 0x8b, script: 0x57, flags: 0x0}, + 595: {region: 0x165, script: 0x57, flags: 0x0}, + 596: {region: 0xab, script: 0x50, flags: 0x0}, + 597: {region: 0x106, script: 0x1f, flags: 0x0}, + 598: {region: 0x99, script: 0x21, flags: 0x0}, + 599: {region: 0x165, script: 0x57, flags: 0x0}, + 600: {region: 0x75, script: 0x57, flags: 0x0}, + 601: {region: 0x165, script: 0x57, flags: 0x0}, + 602: {region: 0xb4, script: 0x57, flags: 0x0}, + 603: {region: 0x165, script: 0x57, flags: 0x0}, + 604: {region: 0x165, script: 0x57, flags: 0x0}, + 605: {region: 0x165, script: 0x57, flags: 0x0}, + 606: {region: 0x165, script: 0x57, flags: 0x0}, + 607: {region: 0x165, script: 0x57, flags: 0x0}, + 608: {region: 0x165, script: 0x57, flags: 0x0}, + 609: {region: 0x165, script: 0x57, flags: 0x0}, + 610: {region: 0x165, script: 0x29, flags: 0x0}, + 611: {region: 0x165, script: 0x57, flags: 0x0}, + 612: {region: 0x106, script: 0x1f, flags: 0x0}, + 613: {region: 0x112, script: 0x57, flags: 0x0}, + 614: {region: 0xe7, script: 0x57, flags: 0x0}, + 615: {region: 0x106, script: 0x57, flags: 0x0}, + 616: {region: 0x165, script: 0x57, flags: 0x0}, + 617: {region: 0x99, script: 0x21, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x57, flags: 0x0}, + 620: {region: 0x165, script: 0x57, flags: 0x0}, + 621: {region: 0x52, script: 0x57, flags: 0x0}, + 622: {region: 0x60, script: 0x57, flags: 0x0}, + 623: {region: 0x165, script: 0x57, flags: 0x0}, + 624: {region: 0x165, script: 0x57, flags: 0x0}, + 625: {region: 0x165, script: 0x29, flags: 0x0}, + 626: {region: 0x165, script: 0x57, flags: 0x0}, + 627: {region: 0x165, script: 0x57, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x57, flags: 0x0}, + 630: {region: 0x165, script: 0x57, flags: 0x0}, + 631: {region: 0x165, script: 0x57, flags: 0x0}, + 632: {region: 0x165, script: 0x57, flags: 0x0}, + 633: {region: 0x106, script: 0x1f, flags: 0x0}, + 634: {region: 0x165, script: 0x57, flags: 0x0}, + 635: {region: 0x165, script: 0x57, flags: 0x0}, + 636: {region: 0x165, script: 0x57, flags: 0x0}, + 637: {region: 0x106, script: 0x1f, flags: 0x0}, + 638: {region: 0x165, script: 0x57, flags: 0x0}, + 639: {region: 0x95, script: 0x57, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x57, flags: 0x0}, + 642: {region: 0x165, script: 0x57, flags: 0x0}, + 643: {region: 0x165, script: 0x57, flags: 0x0}, + 644: {region: 0x165, script: 0x57, flags: 0x0}, + 645: {region: 0x165, script: 0x29, flags: 0x0}, + 646: {region: 0x123, script: 0xdf, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x57, flags: 0x0}, + 649: {region: 0x165, script: 0x57, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x57, flags: 0x0}, + 652: {region: 0x165, script: 0x57, flags: 0x0}, + 653: {region: 0x165, script: 0x57, flags: 0x0}, + 654: {region: 0x138, script: 0x57, flags: 0x0}, + 655: {region: 0x87, script: 0x5b, flags: 0x0}, + 656: {region: 0x97, script: 0x3b, flags: 0x0}, + 657: {region: 0x12f, script: 0x57, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x57, flags: 0x0}, + 660: {region: 0x165, script: 0x57, flags: 0x0}, + 661: {region: 0xb7, script: 0x57, flags: 0x0}, + 662: {region: 0x106, script: 0x1f, flags: 0x0}, + 663: {region: 0x165, script: 0x57, flags: 0x0}, + 664: {region: 0x95, script: 0x57, flags: 0x0}, + 665: {region: 0x165, script: 0x57, flags: 0x0}, + 666: {region: 0x53, script: 0xdf, flags: 0x0}, + 667: {region: 0x165, script: 0x57, flags: 0x0}, + 668: {region: 0x165, script: 0x57, flags: 0x0}, + 669: {region: 0x165, script: 0x57, flags: 0x0}, + 670: {region: 0x165, script: 0x57, flags: 0x0}, + 671: {region: 0x99, script: 0x59, flags: 0x0}, + 672: {region: 0x165, script: 0x57, flags: 0x0}, + 673: {region: 0x165, script: 0x57, flags: 0x0}, + 674: {region: 0x106, script: 0x1f, flags: 0x0}, + 675: {region: 0x131, script: 0x57, flags: 0x0}, + 676: {region: 0x165, script: 0x57, flags: 0x0}, + 677: {region: 0xd9, script: 0x57, flags: 0x0}, + 678: {region: 0x165, script: 0x57, flags: 0x0}, + 679: {region: 0x165, script: 0x57, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x57, flags: 0x0}, + 682: {region: 0x165, script: 0x57, flags: 0x0}, + 683: {region: 0x9e, script: 0x57, flags: 0x0}, + 684: {region: 0x53, script: 0x5d, flags: 0x0}, + 685: {region: 0x95, script: 0x57, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x57, flags: 0x0}, + 688: {region: 0x165, script: 0x57, flags: 0x0}, + 689: {region: 0x165, script: 0x57, flags: 0x0}, + 690: {region: 0x99, script: 0xda, flags: 0x0}, + 691: {region: 0x9e, script: 0x57, flags: 0x0}, + 692: {region: 0x165, script: 0x57, flags: 0x0}, + 693: {region: 0x4b, script: 0x57, flags: 0x0}, + 694: {region: 0x165, script: 0x57, flags: 0x0}, + 695: {region: 0x165, script: 0x57, flags: 0x0}, + 696: {region: 0xaf, script: 0x54, flags: 0x0}, + 697: {region: 0x165, script: 0x57, flags: 0x0}, + 698: {region: 0x165, script: 0x57, flags: 0x0}, + 699: {region: 0x4b, script: 0x57, flags: 0x0}, + 700: {region: 0x165, script: 0x57, flags: 0x0}, + 701: {region: 0x165, script: 0x57, flags: 0x0}, + 702: {region: 0x162, script: 0x57, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x57, flags: 0x0}, + 705: {region: 0xb8, script: 0x57, flags: 0x0}, + 706: {region: 0x4b, script: 0x57, flags: 0x0}, + 707: {region: 0x4b, script: 0x57, flags: 0x0}, + 708: {region: 0xa4, script: 0x57, flags: 0x0}, + 709: {region: 0xa4, script: 0x57, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x57, flags: 0x0}, + 712: {region: 0x123, script: 0xdf, flags: 0x0}, + 713: {region: 0x53, script: 0x38, flags: 0x0}, + 714: {region: 0x12b, script: 0x57, flags: 0x0}, + 715: {region: 0x95, script: 0x57, flags: 0x0}, + 716: {region: 0x52, script: 0x57, flags: 0x0}, + 717: {region: 0x99, script: 0x21, flags: 0x0}, + 718: {region: 0x99, script: 0x21, flags: 0x0}, + 719: {region: 0x95, script: 0x57, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x57, flags: 0x0}, + 722: {region: 0x165, script: 0x57, flags: 0x0}, + 723: {region: 0xcf, script: 0x57, flags: 0x0}, + 724: {region: 0x165, script: 0x57, flags: 0x0}, + 725: {region: 0x165, script: 0x57, flags: 0x0}, + 726: {region: 0x165, script: 0x57, flags: 0x0}, + 727: {region: 0x165, script: 0x57, flags: 0x0}, + 728: {region: 0x165, script: 0x57, flags: 0x0}, + 729: {region: 0x165, script: 0x57, flags: 0x0}, + 730: {region: 0x165, script: 0x57, flags: 0x0}, + 731: {region: 0x165, script: 0x57, flags: 0x0}, + 732: {region: 0x165, script: 0x57, flags: 0x0}, + 733: {region: 0x165, script: 0x57, flags: 0x0}, + 734: {region: 0x165, script: 0x57, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x1f, flags: 0x0}, + 737: {region: 0xe7, script: 0x57, flags: 0x0}, + 738: {region: 0x165, script: 0x57, flags: 0x0}, + 739: {region: 0x95, script: 0x57, flags: 0x0}, + 740: {region: 0x165, script: 0x29, flags: 0x0}, + 741: {region: 0x165, script: 0x57, flags: 0x0}, + 742: {region: 0x165, script: 0x57, flags: 0x0}, + 743: {region: 0x165, script: 0x57, flags: 0x0}, + 744: {region: 0x112, script: 0x57, flags: 0x0}, + 745: {region: 0xa4, script: 0x57, flags: 0x0}, + 746: {region: 0x165, script: 0x57, flags: 0x0}, + 747: {region: 0x165, script: 0x57, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x57, flags: 0x0}, + 750: {region: 0x165, script: 0x57, flags: 0x0}, + 751: {region: 0x165, script: 0x57, flags: 0x0}, + 752: {region: 0x165, script: 0x57, flags: 0x0}, + 753: {region: 0xbf, script: 0x57, flags: 0x0}, + 754: {region: 0xd1, script: 0x57, flags: 0x0}, + 755: {region: 0x165, script: 0x57, flags: 0x0}, + 756: {region: 0x52, script: 0x57, flags: 0x0}, + 757: {region: 0xdb, script: 0x21, flags: 0x0}, + 758: {region: 0x12f, script: 0x57, flags: 0x0}, + 759: {region: 0xc0, script: 0x57, flags: 0x0}, + 760: {region: 0x165, script: 0x57, flags: 0x0}, + 761: {region: 0x165, script: 0x57, flags: 0x0}, + 762: {region: 0xe0, script: 0x57, flags: 0x0}, + 763: {region: 0x165, script: 0x57, flags: 0x0}, + 764: {region: 0x95, script: 0x57, flags: 0x0}, + 765: {region: 0x9b, script: 0x3a, flags: 0x0}, + 766: {region: 0x165, script: 0x57, flags: 0x0}, + 767: {region: 0xc2, script: 0x1f, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x57, flags: 0x0}, + 770: {region: 0x165, script: 0x57, flags: 0x0}, + 771: {region: 0x165, script: 0x57, flags: 0x0}, + 772: {region: 0x99, script: 0x6b, flags: 0x0}, + 773: {region: 0x165, script: 0x57, flags: 0x0}, + 774: {region: 0x165, script: 0x57, flags: 0x0}, + 775: {region: 0x10b, script: 0x57, flags: 0x0}, + 776: {region: 0x165, script: 0x57, flags: 0x0}, + 777: {region: 0x165, script: 0x57, flags: 0x0}, + 778: {region: 0x165, script: 0x57, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x57, flags: 0x0}, + 781: {region: 0x165, script: 0x57, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x72, flags: 0x0}, + 785: {region: 0x165, script: 0x57, flags: 0x0}, + 786: {region: 0x49, script: 0x57, flags: 0x0}, + 787: {region: 0x49, script: 0x57, flags: 0x0}, + 788: {region: 0x37, script: 0x57, flags: 0x0}, + 789: {region: 0x165, script: 0x57, flags: 0x0}, + 790: {region: 0x165, script: 0x57, flags: 0x0}, + 791: {region: 0x165, script: 0x57, flags: 0x0}, + 792: {region: 0x165, script: 0x57, flags: 0x0}, + 793: {region: 0x165, script: 0x57, flags: 0x0}, + 794: {region: 0x165, script: 0x57, flags: 0x0}, + 795: {region: 0x99, script: 0x21, flags: 0x0}, + 796: {region: 0xdb, script: 0x21, flags: 0x0}, + 797: {region: 0x106, script: 0x1f, flags: 0x0}, + 798: {region: 0x35, script: 0x6f, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x57, flags: 0x0}, + 801: {region: 0x165, script: 0x57, flags: 0x0}, + 802: {region: 0x165, script: 0x57, flags: 0x0}, + 803: {region: 0x165, script: 0x57, flags: 0x0}, + 804: {region: 0x99, script: 0x21, flags: 0x0}, + 805: {region: 0x52, script: 0x57, flags: 0x0}, + 807: {region: 0x165, script: 0x57, flags: 0x0}, + 808: {region: 0x135, script: 0x57, flags: 0x0}, + 809: {region: 0x165, script: 0x57, flags: 0x0}, + 810: {region: 0x165, script: 0x57, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x57, flags: 0x0}, + 813: {region: 0x99, script: 0x21, flags: 0x0}, + 814: {region: 0x95, script: 0x57, flags: 0x0}, + 815: {region: 0x164, script: 0x57, flags: 0x0}, + 816: {region: 0x165, script: 0x57, flags: 0x0}, + 817: {region: 0xc4, script: 0x72, flags: 0x0}, + 818: {region: 0x165, script: 0x57, flags: 0x0}, + 819: {region: 0x165, script: 0x29, flags: 0x0}, + 820: {region: 0x106, script: 0x1f, flags: 0x0}, + 821: {region: 0x165, script: 0x57, flags: 0x0}, + 822: {region: 0x131, script: 0x57, flags: 0x0}, + 823: {region: 0x9c, script: 0x63, flags: 0x0}, + 824: {region: 0x165, script: 0x57, flags: 0x0}, + 825: {region: 0x165, script: 0x57, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x57, flags: 0x0}, + 828: {region: 0x165, script: 0x57, flags: 0x0}, + 829: {region: 0x165, script: 0x57, flags: 0x0}, + 830: {region: 0xdd, script: 0x57, flags: 0x0}, + 831: {region: 0x165, script: 0x57, flags: 0x0}, + 832: {region: 0x165, script: 0x57, flags: 0x0}, + 834: {region: 0x165, script: 0x57, flags: 0x0}, + 835: {region: 0x53, script: 0x38, flags: 0x0}, + 836: {region: 0x9e, script: 0x57, flags: 0x0}, + 837: {region: 0xd2, script: 0x57, flags: 0x0}, + 838: {region: 0x165, script: 0x57, flags: 0x0}, + 839: {region: 0xda, script: 0x57, flags: 0x0}, + 840: {region: 0x165, script: 0x57, flags: 0x0}, + 841: {region: 0x165, script: 0x57, flags: 0x0}, + 842: {region: 0x165, script: 0x57, flags: 0x0}, + 843: {region: 0xcf, script: 0x57, flags: 0x0}, + 844: {region: 0x165, script: 0x57, flags: 0x0}, + 845: {region: 0x165, script: 0x57, flags: 0x0}, + 846: {region: 0x164, script: 0x57, flags: 0x0}, + 847: {region: 0xd1, script: 0x57, flags: 0x0}, + 848: {region: 0x60, script: 0x57, flags: 0x0}, + 849: {region: 0xdb, script: 0x21, flags: 0x0}, + 850: {region: 0x165, script: 0x57, flags: 0x0}, + 851: {region: 0xdb, script: 0x21, flags: 0x0}, + 852: {region: 0x165, script: 0x57, flags: 0x0}, + 853: {region: 0x165, script: 0x57, flags: 0x0}, + 854: {region: 0xd2, script: 0x57, flags: 0x0}, + 855: {region: 0x165, script: 0x57, flags: 0x0}, + 856: {region: 0x165, script: 0x57, flags: 0x0}, + 857: {region: 0xd1, script: 0x57, flags: 0x0}, + 858: {region: 0x165, script: 0x57, flags: 0x0}, + 859: {region: 0xcf, script: 0x57, flags: 0x0}, + 860: {region: 0xcf, script: 0x57, flags: 0x0}, + 861: {region: 0x165, script: 0x57, flags: 0x0}, + 862: {region: 0x165, script: 0x57, flags: 0x0}, + 863: {region: 0x95, script: 0x57, flags: 0x0}, + 864: {region: 0x165, script: 0x57, flags: 0x0}, + 865: {region: 0xdf, script: 0x57, flags: 0x0}, + 866: {region: 0x165, script: 0x57, flags: 0x0}, + 867: {region: 0x165, script: 0x57, flags: 0x0}, + 868: {region: 0x99, script: 0x57, flags: 0x0}, + 869: {region: 0x165, script: 0x57, flags: 0x0}, + 870: {region: 0x165, script: 0x57, flags: 0x0}, + 871: {region: 0xd9, script: 0x57, flags: 0x0}, + 872: {region: 0x52, script: 0x57, flags: 0x0}, + 873: {region: 0x165, script: 0x57, flags: 0x0}, + 874: {region: 0xda, script: 0x57, flags: 0x0}, + 875: {region: 0x165, script: 0x57, flags: 0x0}, + 876: {region: 0x52, script: 0x57, flags: 0x0}, + 877: {region: 0x165, script: 0x57, flags: 0x0}, + 878: {region: 0x165, script: 0x57, flags: 0x0}, + 879: {region: 0xda, script: 0x57, flags: 0x0}, + 880: {region: 0x123, script: 0x53, flags: 0x0}, + 881: {region: 0x99, script: 0x21, flags: 0x0}, + 882: {region: 0x10c, script: 0xbf, flags: 0x0}, + 883: {region: 0x165, script: 0x57, flags: 0x0}, + 884: {region: 0x165, script: 0x57, flags: 0x0}, + 885: {region: 0x84, script: 0x78, flags: 0x0}, + 886: {region: 0x161, script: 0x57, flags: 0x0}, + 887: {region: 0x165, script: 0x57, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x57, flags: 0x0}, + 890: {region: 0x161, script: 0x57, flags: 0x0}, + 891: {region: 0x165, script: 0x57, flags: 0x0}, + 892: {region: 0x165, script: 0x57, flags: 0x0}, + 893: {region: 0x165, script: 0x57, flags: 0x0}, + 894: {region: 0x165, script: 0x57, flags: 0x0}, + 895: {region: 0x165, script: 0x57, flags: 0x0}, + 896: {region: 0x117, script: 0x57, flags: 0x0}, + 897: {region: 0x165, script: 0x57, flags: 0x0}, + 898: {region: 0x165, script: 0x57, flags: 0x0}, + 899: {region: 0x135, script: 0x57, flags: 0x0}, + 900: {region: 0x165, script: 0x57, flags: 0x0}, + 901: {region: 0x53, script: 0x57, flags: 0x0}, + 902: {region: 0x165, script: 0x57, flags: 0x0}, + 903: {region: 0xce, script: 0x57, flags: 0x0}, + 904: {region: 0x12f, script: 0x57, flags: 0x0}, + 905: {region: 0x131, script: 0x57, flags: 0x0}, + 906: {region: 0x80, script: 0x57, flags: 0x0}, + 907: {region: 0x78, script: 0x57, flags: 0x0}, + 908: {region: 0x165, script: 0x57, flags: 0x0}, + 910: {region: 0x165, script: 0x57, flags: 0x0}, + 911: {region: 0x165, script: 0x57, flags: 0x0}, + 912: {region: 0x6f, script: 0x57, flags: 0x0}, + 913: {region: 0x165, script: 0x57, flags: 0x0}, + 914: {region: 0x165, script: 0x57, flags: 0x0}, + 915: {region: 0x165, script: 0x57, flags: 0x0}, + 916: {region: 0x165, script: 0x57, flags: 0x0}, + 917: {region: 0x99, script: 0x7d, flags: 0x0}, + 918: {region: 0x165, script: 0x57, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x1f, flags: 0x0}, + 921: {region: 0x135, script: 0x7e, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x7c, flags: 0x0}, + 924: {region: 0x165, script: 0x57, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x57, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x57, flags: 0x0}, + 929: {region: 0x30, script: 0x57, flags: 0x0}, + 930: {region: 0xf0, script: 0x57, flags: 0x0}, + 931: {region: 0x165, script: 0x57, flags: 0x0}, + 932: {region: 0x78, script: 0x57, flags: 0x0}, + 933: {region: 0xd6, script: 0x57, flags: 0x0}, + 934: {region: 0x135, script: 0x57, flags: 0x0}, + 935: {region: 0x49, script: 0x57, flags: 0x0}, + 936: {region: 0x165, script: 0x57, flags: 0x0}, + 937: {region: 0x9c, script: 0xe8, flags: 0x0}, + 938: {region: 0x165, script: 0x57, flags: 0x0}, + 939: {region: 0x60, script: 0x57, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x87, flags: 0x0}, + 943: {region: 0x165, script: 0x57, flags: 0x0}, + 944: {region: 0x165, script: 0x57, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x57, flags: 0x0}, + 947: {region: 0xe9, script: 0x57, flags: 0x0}, + 948: {region: 0x165, script: 0x57, flags: 0x0}, + 949: {region: 0x9e, script: 0x57, flags: 0x0}, + 950: {region: 0x165, script: 0x57, flags: 0x0}, + 951: {region: 0x165, script: 0x57, flags: 0x0}, + 952: {region: 0x87, script: 0x31, flags: 0x0}, + 953: {region: 0x75, script: 0x57, flags: 0x0}, + 954: {region: 0x165, script: 0x57, flags: 0x0}, + 955: {region: 0xe8, script: 0x4a, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x57, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x57, flags: 0x0}, + 960: {region: 0x41, script: 0x57, flags: 0x0}, + 961: {region: 0x165, script: 0x57, flags: 0x0}, + 962: {region: 0x7a, script: 0x57, flags: 0x0}, + 963: {region: 0x165, script: 0x57, flags: 0x0}, + 964: {region: 0xe4, script: 0x57, flags: 0x0}, + 965: {region: 0x89, script: 0x57, flags: 0x0}, + 966: {region: 0x69, script: 0x57, flags: 0x0}, + 967: {region: 0x165, script: 0x57, flags: 0x0}, + 968: {region: 0x99, script: 0x21, flags: 0x0}, + 969: {region: 0x165, script: 0x57, flags: 0x0}, + 970: {region: 0x102, script: 0x57, flags: 0x0}, + 971: {region: 0x95, script: 0x57, flags: 0x0}, + 972: {region: 0x165, script: 0x57, flags: 0x0}, + 973: {region: 0x165, script: 0x57, flags: 0x0}, + 974: {region: 0x9e, script: 0x57, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x57, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x21, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x57, flags: 0x0}, + 981: {region: 0x72, script: 0x57, flags: 0x0}, + 982: {region: 0x4e, script: 0x57, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x57, flags: 0x0}, + 985: {region: 0x3a, script: 0x57, flags: 0x0}, + 986: {region: 0x165, script: 0x57, flags: 0x0}, + 987: {region: 0xd1, script: 0x57, flags: 0x0}, + 988: {region: 0x104, script: 0x57, flags: 0x0}, + 989: {region: 0x95, script: 0x57, flags: 0x0}, + 990: {region: 0x12f, script: 0x57, flags: 0x0}, + 991: {region: 0x165, script: 0x57, flags: 0x0}, + 992: {region: 0x165, script: 0x57, flags: 0x0}, + 993: {region: 0x73, script: 0x57, flags: 0x0}, + 994: {region: 0x106, script: 0x1f, flags: 0x0}, + 995: {region: 0x130, script: 0x1f, flags: 0x0}, + 996: {region: 0x109, script: 0x57, flags: 0x0}, + 997: {region: 0x107, script: 0x57, flags: 0x0}, + 998: {region: 0x12f, script: 0x57, flags: 0x0}, + 999: {region: 0x165, script: 0x57, flags: 0x0}, + 1000: {region: 0xa2, script: 0x49, flags: 0x0}, + 1001: {region: 0x99, script: 0x21, flags: 0x0}, + 1002: {region: 0x80, script: 0x57, flags: 0x0}, + 1003: {region: 0x106, script: 0x1f, flags: 0x0}, + 1004: {region: 0xa4, script: 0x57, flags: 0x0}, + 1005: {region: 0x95, script: 0x57, flags: 0x0}, + 1006: {region: 0x99, script: 0x57, flags: 0x0}, + 1007: {region: 0x114, script: 0x57, flags: 0x0}, + 1008: {region: 0x99, script: 0xc3, flags: 0x0}, + 1009: {region: 0x165, script: 0x57, flags: 0x0}, + 1010: {region: 0x165, script: 0x57, flags: 0x0}, + 1011: {region: 0x12f, script: 0x57, flags: 0x0}, + 1012: {region: 0x9e, script: 0x57, flags: 0x0}, + 1013: {region: 0x99, script: 0x21, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x57, flags: 0x0}, + 1016: {region: 0x7b, script: 0x57, flags: 0x0}, + 1017: {region: 0x49, script: 0x57, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x57, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x57, flags: 0x0}, + 1022: {region: 0x4f, script: 0x57, flags: 0x0}, + 1023: {region: 0xd1, script: 0x57, flags: 0x0}, + 1024: {region: 0xcf, script: 0x57, flags: 0x0}, + 1025: {region: 0xc3, script: 0x57, flags: 0x0}, + 1026: {region: 0x4c, script: 0x57, flags: 0x0}, + 1027: {region: 0x96, script: 0x7a, flags: 0x0}, + 1028: {region: 0xb6, script: 0x57, flags: 0x0}, + 1029: {region: 0x165, script: 0x29, flags: 0x0}, + 1030: {region: 0x165, script: 0x57, flags: 0x0}, + 1032: {region: 0xba, script: 0xdc, flags: 0x0}, + 1033: {region: 0x165, script: 0x57, flags: 0x0}, + 1034: {region: 0xc4, script: 0x72, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xca, flags: 0x0}, + 1037: {region: 0x6f, script: 0x57, flags: 0x0}, + 1038: {region: 0x165, script: 0x57, flags: 0x0}, + 1039: {region: 0x165, script: 0x57, flags: 0x0}, + 1040: {region: 0x165, script: 0x57, flags: 0x0}, + 1041: {region: 0x165, script: 0x57, flags: 0x0}, + 1042: {region: 0x111, script: 0x57, flags: 0x0}, + 1043: {region: 0x165, script: 0x57, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x57, flags: 0x0}, + 1046: {region: 0x10f, script: 0x57, flags: 0x0}, + 1047: {region: 0x165, script: 0x57, flags: 0x0}, + 1048: {region: 0xe9, script: 0x57, flags: 0x0}, + 1049: {region: 0x165, script: 0x57, flags: 0x0}, + 1050: {region: 0x95, script: 0x57, flags: 0x0}, + 1051: {region: 0x142, script: 0x57, flags: 0x0}, + 1052: {region: 0x10c, script: 0x57, flags: 0x0}, + 1054: {region: 0x10c, script: 0x57, flags: 0x0}, + 1055: {region: 0x72, script: 0x57, flags: 0x0}, + 1056: {region: 0x97, script: 0xc0, flags: 0x0}, + 1057: {region: 0x165, script: 0x57, flags: 0x0}, + 1058: {region: 0x72, script: 0x57, flags: 0x0}, + 1059: {region: 0x164, script: 0x57, flags: 0x0}, + 1060: {region: 0x165, script: 0x57, flags: 0x0}, + 1061: {region: 0xc3, script: 0x57, flags: 0x0}, + 1062: {region: 0x165, script: 0x57, flags: 0x0}, + 1063: {region: 0x165, script: 0x57, flags: 0x0}, + 1064: {region: 0x165, script: 0x57, flags: 0x0}, + 1065: {region: 0x115, script: 0x57, flags: 0x0}, + 1066: {region: 0x165, script: 0x57, flags: 0x0}, + 1067: {region: 0x165, script: 0x57, flags: 0x0}, + 1068: {region: 0x123, script: 0xdf, flags: 0x0}, + 1069: {region: 0x165, script: 0x57, flags: 0x0}, + 1070: {region: 0x165, script: 0x57, flags: 0x0}, + 1071: {region: 0x165, script: 0x57, flags: 0x0}, + 1072: {region: 0x165, script: 0x57, flags: 0x0}, + 1073: {region: 0x27, script: 0x57, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xcb, flags: 0x0}, + 1076: {region: 0x116, script: 0x57, flags: 0x0}, + 1077: {region: 0x114, script: 0x57, flags: 0x0}, + 1078: {region: 0x99, script: 0x21, flags: 0x0}, + 1079: {region: 0x161, script: 0x57, flags: 0x0}, + 1080: {region: 0x165, script: 0x57, flags: 0x0}, + 1081: {region: 0x165, script: 0x57, flags: 0x0}, + 1082: {region: 0x6d, script: 0x57, flags: 0x0}, + 1083: {region: 0x161, script: 0x57, flags: 0x0}, + 1084: {region: 0x165, script: 0x57, flags: 0x0}, + 1085: {region: 0x60, script: 0x57, flags: 0x0}, + 1086: {region: 0x95, script: 0x57, flags: 0x0}, + 1087: {region: 0x165, script: 0x57, flags: 0x0}, + 1088: {region: 0x165, script: 0x57, flags: 0x0}, + 1089: {region: 0x12f, script: 0x57, flags: 0x0}, + 1090: {region: 0x165, script: 0x57, flags: 0x0}, + 1091: {region: 0x84, script: 0x57, flags: 0x0}, + 1092: {region: 0x10c, script: 0x57, flags: 0x0}, + 1093: {region: 0x12f, script: 0x57, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x57, flags: 0x0}, + 1096: {region: 0x60, script: 0x57, flags: 0x0}, + 1097: {region: 0x165, script: 0x57, flags: 0x0}, + 1098: {region: 0x99, script: 0x21, flags: 0x0}, + 1099: {region: 0x95, script: 0x57, flags: 0x0}, + 1100: {region: 0x165, script: 0x57, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, + 1103: {region: 0xe9, script: 0x57, flags: 0x0}, + 1104: {region: 0x99, script: 0xd7, flags: 0x0}, + 1105: {region: 0xdb, script: 0x21, flags: 0x0}, + 1106: {region: 0x165, script: 0x57, flags: 0x0}, + 1107: {region: 0x165, script: 0x57, flags: 0x0}, + 1108: {region: 0x165, script: 0x57, flags: 0x0}, + 1109: {region: 0x165, script: 0x57, flags: 0x0}, + 1110: {region: 0x165, script: 0x57, flags: 0x0}, + 1111: {region: 0x165, script: 0x57, flags: 0x0}, + 1112: {region: 0x165, script: 0x57, flags: 0x0}, + 1113: {region: 0x165, script: 0x57, flags: 0x0}, + 1114: {region: 0xe7, script: 0x57, flags: 0x0}, + 1115: {region: 0x165, script: 0x57, flags: 0x0}, + 1116: {region: 0x165, script: 0x57, flags: 0x0}, + 1117: {region: 0x99, script: 0x4f, flags: 0x0}, + 1118: {region: 0x53, script: 0xd5, flags: 0x0}, + 1119: {region: 0xdb, script: 0x21, flags: 0x0}, + 1120: {region: 0xdb, script: 0x21, flags: 0x0}, + 1121: {region: 0x99, script: 0xda, flags: 0x0}, + 1122: {region: 0x165, script: 0x57, flags: 0x0}, + 1123: {region: 0x112, script: 0x57, flags: 0x0}, + 1124: {region: 0x131, script: 0x57, flags: 0x0}, + 1125: {region: 0x126, script: 0x57, flags: 0x0}, + 1126: {region: 0x165, script: 0x57, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x57, flags: 0x0}, + 1129: {region: 0x165, script: 0x57, flags: 0x0}, + 1130: {region: 0x165, script: 0x57, flags: 0x0}, + 1131: {region: 0x123, script: 0xdf, flags: 0x0}, + 1132: {region: 0xdb, script: 0x21, flags: 0x0}, + 1133: {region: 0xdb, script: 0x21, flags: 0x0}, + 1134: {region: 0xdb, script: 0x21, flags: 0x0}, + 1135: {region: 0x6f, script: 0x29, flags: 0x0}, + 1136: {region: 0x165, script: 0x57, flags: 0x0}, + 1137: {region: 0x6d, script: 0x29, flags: 0x0}, + 1138: {region: 0x165, script: 0x57, flags: 0x0}, + 1139: {region: 0x165, script: 0x57, flags: 0x0}, + 1140: {region: 0x165, script: 0x57, flags: 0x0}, + 1141: {region: 0xd6, script: 0x57, flags: 0x0}, + 1142: {region: 0x127, script: 0x57, flags: 0x0}, + 1143: {region: 0x125, script: 0x57, flags: 0x0}, + 1144: {region: 0x32, script: 0x57, flags: 0x0}, + 1145: {region: 0xdb, script: 0x21, flags: 0x0}, + 1146: {region: 0xe7, script: 0x57, flags: 0x0}, + 1147: {region: 0x165, script: 0x57, flags: 0x0}, + 1148: {region: 0x165, script: 0x57, flags: 0x0}, + 1149: {region: 0x32, script: 0x57, flags: 0x0}, + 1150: {region: 0xd4, script: 0x57, flags: 0x0}, + 1151: {region: 0x165, script: 0x57, flags: 0x0}, + 1152: {region: 0x161, script: 0x57, flags: 0x0}, + 1153: {region: 0x165, script: 0x57, flags: 0x0}, + 1154: {region: 0x129, script: 0x57, flags: 0x0}, + 1155: {region: 0x165, script: 0x57, flags: 0x0}, + 1156: {region: 0xce, script: 0x57, flags: 0x0}, + 1157: {region: 0x165, script: 0x57, flags: 0x0}, + 1158: {region: 0xe6, script: 0x57, flags: 0x0}, + 1159: {region: 0x165, script: 0x57, flags: 0x0}, + 1160: {region: 0x165, script: 0x57, flags: 0x0}, + 1161: {region: 0x165, script: 0x57, flags: 0x0}, + 1162: {region: 0x12b, script: 0x57, flags: 0x0}, + 1163: {region: 0x12b, script: 0x57, flags: 0x0}, + 1164: {region: 0x12e, script: 0x57, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x57, flags: 0x0}, + 1167: {region: 0x87, script: 0x31, flags: 0x0}, + 1168: {region: 0xdb, script: 0x21, flags: 0x0}, + 1169: {region: 0xe7, script: 0x57, flags: 0x0}, + 1170: {region: 0x43, script: 0xe0, flags: 0x0}, + 1171: {region: 0x165, script: 0x57, flags: 0x0}, + 1172: {region: 0x106, script: 0x1f, flags: 0x0}, + 1173: {region: 0x165, script: 0x57, flags: 0x0}, + 1174: {region: 0x165, script: 0x57, flags: 0x0}, + 1175: {region: 0x131, script: 0x57, flags: 0x0}, + 1176: {region: 0x165, script: 0x57, flags: 0x0}, + 1177: {region: 0x123, script: 0xdf, flags: 0x0}, + 1178: {region: 0x32, script: 0x57, flags: 0x0}, + 1179: {region: 0x165, script: 0x57, flags: 0x0}, + 1180: {region: 0x165, script: 0x57, flags: 0x0}, + 1181: {region: 0xce, script: 0x57, flags: 0x0}, + 1182: {region: 0x165, script: 0x57, flags: 0x0}, + 1183: {region: 0x165, script: 0x57, flags: 0x0}, + 1184: {region: 0x12d, script: 0x57, flags: 0x0}, + 1185: {region: 0x165, script: 0x57, flags: 0x0}, + 1187: {region: 0x165, script: 0x57, flags: 0x0}, + 1188: {region: 0xd4, script: 0x57, flags: 0x0}, + 1189: {region: 0x53, script: 0xd8, flags: 0x0}, + 1190: {region: 0xe5, script: 0x57, flags: 0x0}, + 1191: {region: 0x165, script: 0x57, flags: 0x0}, + 1192: {region: 0x106, script: 0x1f, flags: 0x0}, + 1193: {region: 0xba, script: 0x57, flags: 0x0}, + 1194: {region: 0x165, script: 0x57, flags: 0x0}, + 1195: {region: 0x106, script: 0x1f, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, + 1198: {region: 0x130, script: 0x1f, flags: 0x0}, + 1199: {region: 0x75, script: 0x57, flags: 0x0}, + 1200: {region: 0x2a, script: 0x57, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x57, flags: 0x0}, + 1206: {region: 0x165, script: 0x57, flags: 0x0}, + 1207: {region: 0x165, script: 0x57, flags: 0x0}, + 1208: {region: 0x165, script: 0x57, flags: 0x0}, + 1209: {region: 0x165, script: 0x57, flags: 0x0}, + 1210: {region: 0x165, script: 0x57, flags: 0x0}, + 1211: {region: 0x165, script: 0x57, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x57, flags: 0x0}, + 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, + 1215: {region: 0x165, script: 0x57, flags: 0x0}, + 1216: {region: 0x161, script: 0x57, flags: 0x0}, + 1217: {region: 0x9e, script: 0x57, flags: 0x0}, + 1218: {region: 0x106, script: 0x57, flags: 0x0}, + 1219: {region: 0x13e, script: 0x57, flags: 0x0}, + 1220: {region: 0x11b, script: 0x57, flags: 0x0}, + 1221: {region: 0x165, script: 0x57, flags: 0x0}, + 1222: {region: 0x36, script: 0x57, flags: 0x0}, + 1223: {region: 0x60, script: 0x57, flags: 0x0}, + 1224: {region: 0xd1, script: 0x57, flags: 0x0}, + 1225: {region: 0x1, script: 0x57, flags: 0x0}, + 1226: {region: 0x106, script: 0x57, flags: 0x0}, + 1227: {region: 0x6a, script: 0x57, flags: 0x0}, + 1228: {region: 0x12f, script: 0x57, flags: 0x0}, + 1229: {region: 0x165, script: 0x57, flags: 0x0}, + 1230: {region: 0x36, script: 0x57, flags: 0x0}, + 1231: {region: 0x4e, script: 0x57, flags: 0x0}, + 1232: {region: 0x165, script: 0x57, flags: 0x0}, + 1233: {region: 0x6f, script: 0x29, flags: 0x0}, + 1234: {region: 0x165, script: 0x57, flags: 0x0}, + 1235: {region: 0xe7, script: 0x57, flags: 0x0}, + 1236: {region: 0x2f, script: 0x57, flags: 0x0}, + 1237: {region: 0x99, script: 0xda, flags: 0x0}, + 1238: {region: 0x99, script: 0x21, flags: 0x0}, + 1239: {region: 0x165, script: 0x57, flags: 0x0}, + 1240: {region: 0x165, script: 0x57, flags: 0x0}, + 1241: {region: 0x165, script: 0x57, flags: 0x0}, + 1242: {region: 0x165, script: 0x57, flags: 0x0}, + 1243: {region: 0x165, script: 0x57, flags: 0x0}, + 1244: {region: 0x165, script: 0x57, flags: 0x0}, + 1245: {region: 0x165, script: 0x57, flags: 0x0}, + 1246: {region: 0x165, script: 0x57, flags: 0x0}, + 1247: {region: 0x165, script: 0x57, flags: 0x0}, + 1248: {region: 0x140, script: 0x57, flags: 0x0}, + 1249: {region: 0x165, script: 0x57, flags: 0x0}, + 1250: {region: 0x165, script: 0x57, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x57, flags: 0x0}, + 1253: {region: 0x114, script: 0x57, flags: 0x0}, + 1254: {region: 0x165, script: 0x57, flags: 0x0}, + 1255: {region: 0x165, script: 0x57, flags: 0x0}, + 1256: {region: 0x165, script: 0x57, flags: 0x0}, + 1257: {region: 0x165, script: 0x57, flags: 0x0}, + 1258: {region: 0x99, script: 0x21, flags: 0x0}, + 1259: {region: 0x53, script: 0x38, flags: 0x0}, + 1260: {region: 0x165, script: 0x57, flags: 0x0}, + 1261: {region: 0x165, script: 0x57, flags: 0x0}, + 1262: {region: 0x41, script: 0x57, flags: 0x0}, + 1263: {region: 0x165, script: 0x57, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x57, flags: 0x0}, + 1266: {region: 0x161, script: 0x57, flags: 0x0}, + 1267: {region: 0x165, script: 0x57, flags: 0x0}, + 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, + 1269: {region: 0x12b, script: 0x60, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, + 1271: {region: 0x53, script: 0x64, flags: 0x0}, + 1272: {region: 0x10b, script: 0x69, flags: 0x0}, + 1273: {region: 0x108, script: 0x73, flags: 0x0}, + 1274: {region: 0x99, script: 0x21, flags: 0x0}, + 1275: {region: 0x131, script: 0x57, flags: 0x0}, + 1276: {region: 0x165, script: 0x57, flags: 0x0}, + 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, + 1278: {region: 0x165, script: 0x57, flags: 0x0}, + 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, + 1280: {region: 0x165, script: 0x57, flags: 0x0}, + 1281: {region: 0x165, script: 0x57, flags: 0x0}, + 1282: {region: 0xdb, script: 0x21, flags: 0x0}, + 1283: {region: 0x165, script: 0x57, flags: 0x0}, + 1284: {region: 0x165, script: 0x57, flags: 0x0}, + 1285: {region: 0xd1, script: 0x57, flags: 0x0}, + 1286: {region: 0x75, script: 0x57, flags: 0x0}, + 1287: {region: 0x165, script: 0x57, flags: 0x0}, + 1288: {region: 0x165, script: 0x57, flags: 0x0}, + 1289: {region: 0x52, script: 0x57, flags: 0x0}, + 1290: {region: 0x165, script: 0x57, flags: 0x0}, + 1291: {region: 0x165, script: 0x57, flags: 0x0}, + 1292: {region: 0x165, script: 0x57, flags: 0x0}, + 1293: {region: 0x52, script: 0x57, flags: 0x0}, + 1294: {region: 0x165, script: 0x57, flags: 0x0}, + 1295: {region: 0x165, script: 0x57, flags: 0x0}, + 1296: {region: 0x165, script: 0x57, flags: 0x0}, + 1297: {region: 0x165, script: 0x57, flags: 0x0}, + 1298: {region: 0x1, script: 0x3b, flags: 0x0}, + 1299: {region: 0x165, script: 0x57, flags: 0x0}, + 1300: {region: 0x165, script: 0x57, flags: 0x0}, + 1301: {region: 0x165, script: 0x57, flags: 0x0}, + 1302: {region: 0x165, script: 0x57, flags: 0x0}, + 1303: {region: 0x165, script: 0x57, flags: 0x0}, + 1304: {region: 0xd6, script: 0x57, flags: 0x0}, + 1305: {region: 0x165, script: 0x57, flags: 0x0}, + 1306: {region: 0x165, script: 0x57, flags: 0x0}, + 1307: {region: 0x165, script: 0x57, flags: 0x0}, + 1308: {region: 0x41, script: 0x57, flags: 0x0}, + 1309: {region: 0x165, script: 0x57, flags: 0x0}, + 1310: {region: 0xcf, script: 0x57, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x57, flags: 0x0}, + 1313: {region: 0x165, script: 0x57, flags: 0x0}, + 1314: {region: 0x165, script: 0x57, flags: 0x0}, + 1315: {region: 0x53, script: 0x57, flags: 0x0}, + 1316: {region: 0x10b, script: 0x57, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x57, flags: 0x0}, + 1320: {region: 0xba, script: 0xdc, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x79, flags: 0x0}, + 1323: {region: 0x165, script: 0x57, flags: 0x0}, + 1324: {region: 0x122, script: 0x57, flags: 0x0}, + 1325: {region: 0xd0, script: 0x57, flags: 0x0}, + 1326: {region: 0x165, script: 0x57, flags: 0x0}, + 1327: {region: 0x161, script: 0x57, flags: 0x0}, + 1329: {region: 0x12b, script: 0x57, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x74, flags: 0x2}, + 2: {region: 0x11c, script: 0x80, flags: 0x2}, + 3: {region: 0x32, script: 0x57, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x1f, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x1f, flags: 0x0}, + 9: {region: 0x38, script: 0x2c, flags: 0x2}, + 10: {region: 0x135, script: 0x57, flags: 0x0}, + 11: {region: 0x7b, script: 0xc5, flags: 0x2}, + 12: {region: 0x114, script: 0x57, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1e, flags: 0x0}, + 15: {region: 0x87, script: 0x5c, flags: 0x2}, + 16: {region: 0xd6, script: 0x57, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x1f, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x57, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x1f, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x57, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x57, flags: 0x2}, + 33: {region: 0xdb, script: 0x21, flags: 0x0}, + 34: {region: 0x99, script: 0x5a, flags: 0x2}, + 35: {region: 0x83, script: 0x57, flags: 0x0}, + 36: {region: 0x84, script: 0x78, flags: 0x4}, + 37: {region: 0x84, script: 0x78, flags: 0x2}, + 38: {region: 0xc5, script: 0x1f, flags: 0x0}, + 39: {region: 0x53, script: 0x6d, flags: 0x4}, + 40: {region: 0x53, script: 0x6d, flags: 0x2}, + 41: {region: 0xd0, script: 0x57, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x33, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x84, flags: 0x0}, + 48: {region: 0x53, script: 0x85, flags: 0x2}, + 49: {region: 0xba, script: 0xdc, flags: 0x0}, + 50: {region: 0xd9, script: 0x57, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x21, flags: 0x2}, + 53: {region: 0x99, script: 0x4c, flags: 0x2}, + 54: {region: 0x99, script: 0xc9, flags: 0x2}, + 55: {region: 0x105, script: 0x1f, flags: 0x0}, + 56: {region: 0xbd, script: 0x57, flags: 0x4}, + 57: {region: 0x104, script: 0x57, flags: 0x4}, + 58: {region: 0x106, script: 0x57, flags: 0x4}, + 59: {region: 0x12b, script: 0x57, flags: 0x4}, + 60: {region: 0x124, script: 0x1f, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x1f, flags: 0x4}, + 65: {region: 0xc5, script: 0x1f, flags: 0x4}, + 66: {region: 0xae, script: 0x1f, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x21, flags: 0x4}, + 69: {region: 0xdb, script: 0x21, flags: 0x2}, + 70: {region: 0x137, script: 0x57, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x1f, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x39, flags: 0x0}, + 75: {region: 0x53, script: 0x38, flags: 0x4}, + 76: {region: 0x53, script: 0x38, flags: 0x2}, + 77: {region: 0x53, script: 0x38, flags: 0x0}, + 78: {region: 0x2f, script: 0x39, flags: 0x4}, + 79: {region: 0x3e, script: 0x39, flags: 0x4}, + 80: {region: 0x7b, script: 0x39, flags: 0x4}, + 81: {region: 0x7e, script: 0x39, flags: 0x4}, + 82: {region: 0x8d, script: 0x39, flags: 0x4}, + 83: {region: 0x95, script: 0x39, flags: 0x4}, + 84: {region: 0xc6, script: 0x39, flags: 0x4}, + 85: {region: 0xd0, script: 0x39, flags: 0x4}, + 86: {region: 0xe2, script: 0x39, flags: 0x4}, + 87: {region: 0xe5, script: 0x39, flags: 0x4}, + 88: {region: 0xe7, script: 0x39, flags: 0x4}, + 89: {region: 0x116, script: 0x39, flags: 0x4}, + 90: {region: 0x123, script: 0x39, flags: 0x4}, + 91: {region: 0x12e, script: 0x39, flags: 0x4}, + 92: {region: 0x135, script: 0x39, flags: 0x4}, + 93: {region: 0x13e, script: 0x39, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x34, flags: 0x2}, + 96: {region: 0x12e, script: 0x39, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 1432 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x57, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 43: {lang: 0x0, script: 0x57, flags: 0x0}, + 44: {lang: 0x13e, script: 0x57, flags: 0x0}, + 45: {lang: 0x41b, script: 0x57, flags: 0x0}, + 46: {lang: 0x10d, script: 0x57, flags: 0x0}, + 48: {lang: 0x367, script: 0x57, flags: 0x0}, + 49: {lang: 0x444, script: 0x57, flags: 0x0}, + 50: {lang: 0x58, script: 0x57, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x57, flags: 0x0}, + 55: {lang: 0x15e, script: 0x57, flags: 0x0}, + 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, + 59: {lang: 0x15e, script: 0x57, flags: 0x0}, + 60: {lang: 0x15e, script: 0x57, flags: 0x0}, + 62: {lang: 0x31f, script: 0x57, flags: 0x0}, + 63: {lang: 0x13e, script: 0x57, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x57, flags: 0x0}, + 71: {lang: 0x71, script: 0x1f, flags: 0x0}, + 73: {lang: 0x512, script: 0x3b, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x57, flags: 0x0}, + 76: {lang: 0x15e, script: 0x57, flags: 0x0}, + 77: {lang: 0x15e, script: 0x57, flags: 0x0}, + 78: {lang: 0x10d, script: 0x57, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 81: {lang: 0x13e, script: 0x57, flags: 0x0}, + 82: {lang: 0x15e, script: 0x57, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x57, flags: 0x0}, + 85: {lang: 0x0, script: 0x57, flags: 0x0}, + 86: {lang: 0x13e, script: 0x57, flags: 0x0}, + 89: {lang: 0x13e, script: 0x57, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x57, flags: 0x0}, + 96: {lang: 0x10d, script: 0x57, flags: 0x0}, + 98: {lang: 0x1, script: 0x57, flags: 0x0}, + 99: {lang: 0x101, script: 0x57, flags: 0x0}, + 101: {lang: 0x13e, script: 0x57, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x57, flags: 0x0}, + 105: {lang: 0x13e, script: 0x57, flags: 0x0}, + 106: {lang: 0x140, script: 0x57, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x29, flags: 0x0}, + 110: {lang: 0x13e, script: 0x57, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x57, flags: 0x0}, + 114: {lang: 0x151, script: 0x57, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, + 118: {lang: 0x158, script: 0x57, flags: 0x0}, + 120: {lang: 0x15e, script: 0x57, flags: 0x0}, + 122: {lang: 0x15e, script: 0x57, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x57, flags: 0x0}, + 128: {lang: 0x21, script: 0x57, flags: 0x0}, + 130: {lang: 0x245, script: 0x57, flags: 0x0}, + 132: {lang: 0x15e, script: 0x57, flags: 0x0}, + 133: {lang: 0x15e, script: 0x57, flags: 0x0}, + 134: {lang: 0x13e, script: 0x57, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x57, flags: 0x0}, + 137: {lang: 0x13e, script: 0x57, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 141: {lang: 0x529, script: 0x39, flags: 0x0}, + 142: {lang: 0x0, script: 0x57, flags: 0x0}, + 143: {lang: 0x13e, script: 0x57, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, + 148: {lang: 0x13e, script: 0x57, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x46, flags: 0x0}, + 164: {lang: 0x445, script: 0x57, flags: 0x0}, + 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x50, flags: 0x0}, + 171: {lang: 0x254, script: 0x50, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x57, flags: 0x0}, + 179: {lang: 0x40c, script: 0xca, flags: 0x0}, + 181: {lang: 0x43b, script: 0x57, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, + 183: {lang: 0x15e, script: 0x57, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x57, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x57, flags: 0x0}, + 190: {lang: 0x15e, script: 0x57, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x57, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x57, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x57, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xde, flags: 0x0}, + 207: {lang: 0x13e, script: 0x57, flags: 0x0}, + 208: {lang: 0x31f, script: 0x57, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 210: {lang: 0x16, script: 0x57, flags: 0x0}, + 211: {lang: 0x15e, script: 0x57, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x57, flags: 0x0}, + 217: {lang: 0x367, script: 0x57, flags: 0x0}, + 218: {lang: 0x347, script: 0x57, flags: 0x0}, + 219: {lang: 0x351, script: 0x21, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x57, flags: 0x0}, + 228: {lang: 0x13e, script: 0x57, flags: 0x0}, + 229: {lang: 0x15e, script: 0x57, flags: 0x0}, + 230: {lang: 0x486, script: 0x57, flags: 0x0}, + 231: {lang: 0x153, script: 0x57, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 234: {lang: 0x15e, script: 0x57, flags: 0x0}, + 236: {lang: 0x13e, script: 0x57, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, + 241: {lang: 0x194, script: 0x57, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x57, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x1f, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x57, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x57, flags: 0x0}, + 272: {lang: 0x347, script: 0x57, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 276: {lang: 0x15e, script: 0x57, flags: 0x0}, + 277: {lang: 0x429, script: 0x57, flags: 0x0}, + 278: {lang: 0x367, script: 0x57, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 282: {lang: 0x13e, script: 0x57, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x57, flags: 0x0}, + 289: {lang: 0x15e, script: 0x57, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x57, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 295: {lang: 0x476, script: 0x57, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x57, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x57, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x57, flags: 0x0}, + 309: {lang: 0x512, script: 0x3b, flags: 0x2}, + 310: {lang: 0x13e, script: 0x57, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 315: {lang: 0x13e, script: 0x57, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, + 319: {lang: 0x8a, script: 0x57, flags: 0x0}, + 320: {lang: 0x15e, script: 0x57, flags: 0x0}, + 322: {lang: 0x41b, script: 0x57, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x57, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 372 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x57, flags: 0x0}, + 2: {lang: 0x431, script: 0x57, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x57, flags: 0x0}, + 6: {lang: 0xb7, script: 0x57, flags: 0x0}, + 7: {lang: 0x432, script: 0x1f, flags: 0x0}, + 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, + 9: {lang: 0x351, script: 0x21, flags: 0x0}, + 10: {lang: 0x529, script: 0x38, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x57, flags: 0x0}, + 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, + 14: {lang: 0x136, script: 0x31, flags: 0x0}, + 15: {lang: 0x48a, script: 0x57, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x57, flags: 0x0}, + 18: {lang: 0x27, script: 0x29, flags: 0x0}, + 19: {lang: 0x139, script: 0x57, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3b, flags: 0x2}, + 22: {lang: 0x210, script: 0x2b, flags: 0x0}, + 23: {lang: 0x5, script: 0x1f, flags: 0x0}, + 24: {lang: 0x274, script: 0x57, flags: 0x0}, + 25: {lang: 0x136, script: 0x31, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x21, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x72, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x57, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xdf, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x57, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, + 40: {lang: 0x226, script: 0xdf, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x57, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 46: {lang: 0x431, script: 0x57, flags: 0x0}, + 47: {lang: 0x331, script: 0x72, flags: 0x0}, + 48: {lang: 0x213, script: 0x57, flags: 0x0}, + 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x39, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x57, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x21, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x21, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 64: {lang: 0x267, script: 0x57, flags: 0x0}, + 65: {lang: 0x444, script: 0x57, flags: 0x0}, + 66: {lang: 0x512, script: 0x3b, flags: 0x0}, + 67: {lang: 0x412, script: 0x57, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x57, flags: 0x0}, + 71: {lang: 0x15e, script: 0x57, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x72, flags: 0x0}, + 76: {lang: 0x467, script: 0x1f, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 80: {lang: 0x48a, script: 0x57, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x1f, flags: 0x0}, + 83: {lang: 0x81, script: 0x31, flags: 0x0}, + 84: {lang: 0x529, script: 0x39, flags: 0x0}, + 85: {lang: 0x48c, script: 0x57, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 87: {lang: 0x512, script: 0x3b, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 89: {lang: 0x431, script: 0x57, flags: 0x0}, + 90: {lang: 0x432, script: 0x1f, flags: 0x0}, + 91: {lang: 0x15e, script: 0x57, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint8 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x57}, + 2: {lang: 0x139, region: 0x135, script: 0x57}, + 3: {lang: 0x3c0, region: 0x41, script: 0x57}, + 4: {lang: 0x139, region: 0x2f, script: 0x57}, + 5: {lang: 0x139, region: 0xd6, script: 0x57}, + 6: {lang: 0x13e, region: 0xcf, script: 0x57}, + 7: {lang: 0x445, region: 0x12f, script: 0x57}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x57}, + 10: {lang: 0x139, region: 0x161, script: 0x57}, + 11: {lang: 0x139, region: 0x135, script: 0x57}, + 12: {lang: 0x139, region: 0x135, script: 0x57}, + 13: {lang: 0x13e, region: 0x59, script: 0x57}, + 14: {lang: 0x529, region: 0x53, script: 0x38}, + 15: {lang: 0x1be, region: 0x99, script: 0x21}, + 16: {lang: 0x1e1, region: 0x95, script: 0x57}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, + 18: {lang: 0x139, region: 0x2f, script: 0x57}, + 19: {lang: 0x139, region: 0xe6, script: 0x57}, + 20: {lang: 0x139, region: 0x8a, script: 0x57}, + 21: {lang: 0x41b, region: 0x142, script: 0x57}, + 22: {lang: 0x529, region: 0x53, script: 0x38}, + 23: {lang: 0x4bc, region: 0x137, script: 0x57}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 27: {lang: 0x139, region: 0x7b, script: 0x57}, + 28: {lang: 0x10d, region: 0x60, script: 0x57}, + 29: {lang: 0x139, region: 0xd6, script: 0x57}, + 30: {lang: 0x13e, region: 0x1f, script: 0x57}, + 31: {lang: 0x139, region: 0x9a, script: 0x57}, + 32: {lang: 0x139, region: 0x7b, script: 0x57}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 25886 bytes (25KiB); checksum: 50D3D57D diff --git a/src/dma/vendor/golang.org/x/text/internal/language/tags.go b/src/dma/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 00000000..e7afd318 --- /dev/null +++ b/src/dma/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag |