aboutsummaryrefslogtreecommitdiffstats
path: root/src/dma/vendor/golang.org/x/text/internal
diff options
context:
space:
mode:
Diffstat (limited to 'src/dma/vendor/golang.org/x/text/internal')
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/collelem.go371
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/colltab.go105
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/contract.go145
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/iter.go178
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/numeric.go236
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/table.go275
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/trie.go159
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/colltab/weighter.go31
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/gen/code.go375
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/gen/gen.go347
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/common.go16
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact.go29
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/compact.go61
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/gen.go64
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/gen_index.go113
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/gen_parents.go54
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/language.go260
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/parents.go120
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/tables.go1015
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compact/tags.go91
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/compose.go167
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/coverage.go28
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/gen.go1520
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/gen_common.go20
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/language.go596
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/lookup.go412
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/match.go226
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/parse.go594
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/tables.go3431
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/language/tags.go48
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/tag/tag.go100
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/triegen/compact.go58
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/triegen/print.go251
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/triegen/triegen.go494
-rw-r--r--src/dma/vendor/golang.org/x/text/internal/ucd/ucd.go371
35 files changed, 12361 insertions, 0 deletions
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/collelem.go b/src/dma/vendor/golang.org/x/text/internal/colltab/collelem.go
new file mode 100644
index 00000000..396cebda
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/collelem.go
@@ -0,0 +1,371 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import (
+ "fmt"
+ "unicode"
+)
+
+// Level identifies the collation comparison level.
+// The primary level corresponds to the basic sorting of text.
+// The secondary level corresponds to accents and related linguistic elements.
+// The tertiary level corresponds to casing and related concepts.
+// The quaternary level is derived from the other levels by the
+// various algorithms for handling variable elements.
+type Level int
+
+const (
+ Primary Level = iota
+ Secondary
+ Tertiary
+ Quaternary
+ Identity
+
+ NumLevels
+)
+
+const (
+ defaultSecondary = 0x20
+ defaultTertiary = 0x2
+ maxTertiary = 0x1F
+ MaxQuaternary = 0x1FFFFF // 21 bits.
+)
+
+// Elem is a representation of a collation element. This API provides ways to encode
+// and decode Elems. Implementations of collation tables may use values greater
+// or equal to PrivateUse for their own purposes. However, these should never be
+// returned by AppendNext.
+type Elem uint32
+
+const (
+ maxCE Elem = 0xAFFFFFFF
+ PrivateUse = minContract
+ minContract = 0xC0000000
+ maxContract = 0xDFFFFFFF
+ minExpand = 0xE0000000
+ maxExpand = 0xEFFFFFFF
+ minDecomp = 0xF0000000
+)
+
+type ceType int
+
+const (
+ ceNormal ceType = iota // ceNormal includes implicits (ce == 0)
+ ceContractionIndex // rune can be a start of a contraction
+ ceExpansionIndex // rune expands into a sequence of collation elements
+ ceDecompose // rune expands using NFKC decomposition
+)
+
+func (ce Elem) ctype() ceType {
+ if ce <= maxCE {
+ return ceNormal
+ }
+ if ce <= maxContract {
+ return ceContractionIndex
+ } else {
+ if ce <= maxExpand {
+ return ceExpansionIndex
+ }
+ return ceDecompose
+ }
+ panic("should not reach here")
+ return ceType(-1)
+}
+
+// For normal collation elements, we assume that a collation element either has
+// a primary or non-default secondary value, not both.
+// Collation elements with a primary value are of the form
+// 01pppppp pppppppp ppppppp0 ssssssss
+// - p* is primary collation value
+// - s* is the secondary collation value
+// 00pppppp pppppppp ppppppps sssttttt, where
+// - p* is primary collation value
+// - s* offset of secondary from default value.
+// - t* is the tertiary collation value
+// 100ttttt cccccccc pppppppp pppppppp
+// - t* is the tertiar collation value
+// - c* is the canonical combining class
+// - p* is the primary collation value
+// Collation elements with a secondary value are of the form
+// 1010cccc ccccssss ssssssss tttttttt, where
+// - c* is the canonical combining class
+// - s* is the secondary collation value
+// - t* is the tertiary collation value
+// 11qqqqqq qqqqqqqq qqqqqqq0 00000000
+// - q* quaternary value
+const (
+ ceTypeMask = 0xC0000000
+ ceTypeMaskExt = 0xE0000000
+ ceIgnoreMask = 0xF00FFFFF
+ ceType1 = 0x40000000
+ ceType2 = 0x00000000
+ ceType3or4 = 0x80000000
+ ceType4 = 0xA0000000
+ ceTypeQ = 0xC0000000
+ Ignore = ceType4
+ firstNonPrimary = 0x80000000
+ lastSpecialPrimary = 0xA0000000
+ secondaryMask = 0x80000000
+ hasTertiaryMask = 0x40000000
+ primaryValueMask = 0x3FFFFE00
+ maxPrimaryBits = 21
+ compactPrimaryBits = 16
+ maxSecondaryBits = 12
+ maxTertiaryBits = 8
+ maxCCCBits = 8
+ maxSecondaryCompactBits = 8
+ maxSecondaryDiffBits = 4
+ maxTertiaryCompactBits = 5
+ primaryShift = 9
+ compactSecondaryShift = 5
+ minCompactSecondary = defaultSecondary - 4
+)
+
+func makeImplicitCE(primary int) Elem {
+ return ceType1 | Elem(primary<<primaryShift) | defaultSecondary
+}
+
+// MakeElem returns an Elem for the given values. It will return an error
+// if the given combination of values is invalid.
+func MakeElem(primary, secondary, tertiary int, ccc uint8) (Elem, error) {
+ if w := primary; w >= 1<<maxPrimaryBits || w < 0 {
+ return 0, fmt.Errorf("makeCE: primary weight out of bounds: %x >= %x", w, 1<<maxPrimaryBits)
+ }
+ if w := secondary; w >= 1<<maxSecondaryBits || w < 0 {
+ return 0, fmt.Errorf("makeCE: secondary weight out of bounds: %x >= %x", w, 1<<maxSecondaryBits)
+ }
+ if w := tertiary; w >= 1<<maxTertiaryBits || w < 0 {
+ return 0, fmt.Errorf("makeCE: tertiary weight out of bounds: %x >= %x", w, 1<<maxTertiaryBits)
+ }
+ ce := Elem(0)
+ if primary != 0 {
+ if ccc != 0 {
+ if primary >= 1<<compactPrimaryBits {
+ return 0, fmt.Errorf("makeCE: primary weight with non-zero CCC out of bounds: %x >= %x", primary, 1<<compactPrimaryBits)
+ }
+ if secondary != defaultSecondary {
+ return 0, fmt.Errorf("makeCE: cannot combine non-default secondary value (%x) with non-zero CCC (%x)", secondary, ccc)
+ }
+ ce = Elem(tertiary << (compactPrimaryBits + maxCCCBits))
+ ce |= Elem(ccc) << compactPrimaryBits
+ ce |= Elem(primary)
+ ce |= ceType3or4
+ } else if tertiary == defaultTertiary {
+ if secondary >= 1<<maxSecondaryCompactBits {
+ return 0, fmt.Errorf("makeCE: secondary weight with non-zero primary out of bounds: %x >= %x", secondary, 1<<maxSecondaryCompactBits)
+ }
+ ce = Elem(primary<<(maxSecondaryCompactBits+1) + secondary)
+ ce |= ceType1
+ } else {
+ d := secondary - defaultSecondary + maxSecondaryDiffBits
+ if d >= 1<<maxSecondaryDiffBits || d < 0 {
+ return 0, fmt.Errorf("makeCE: secondary weight diff out of bounds: %x < 0 || %x > %x", d, d, 1<<maxSecondaryDiffBits)
+ }
+ if tertiary >= 1<<maxTertiaryCompactBits {
+ return 0, fmt.Errorf("makeCE: tertiary weight with non-zero primary out of bounds: %x > %x", tertiary, 1<<maxTertiaryCompactBits)
+ }
+ ce = Elem(primary<<maxSecondaryDiffBits + d)
+ ce = ce<<maxTertiaryCompactBits + Elem(tertiary)
+ }
+ } else {
+ ce = Elem(secondary<<maxTertiaryBits + tertiary)
+ ce += Elem(ccc) << (maxSecondaryBits + maxTertiaryBits)
+ ce |= ceType4
+ }
+ return ce, nil
+}
+
+// MakeQuaternary returns an Elem with the given quaternary value.
+func MakeQuaternary(v int) Elem {
+ return ceTypeQ | Elem(v<<primaryShift)
+}
+
+// Mask sets weights for any level smaller than l to 0.
+// The resulting Elem can be used to test for equality with
+// other Elems to which the same mask has been applied.
+func (ce Elem) Mask(l Level) uint32 {
+ return 0
+}
+
+// CCC returns the canonical combining class associated with the underlying character,
+// if applicable, or 0 otherwise.
+func (ce Elem) CCC() uint8 {
+ if ce&ceType3or4 != 0 {
+ if ce&ceType4 == ceType3or4 {
+ return uint8(ce >> 16)
+ }
+ return uint8(ce >> 20)
+ }
+ return 0
+}
+
+// Primary returns the primary collation weight for ce.
+func (ce Elem) Primary() int {
+ if ce >= firstNonPrimary {
+ if ce > lastSpecialPrimary {
+ return 0
+ }
+ return int(uint16(ce))
+ }
+ return int(ce&primaryValueMask) >> primaryShift
+}
+
+// Secondary returns the secondary collation weight for ce.
+func (ce Elem) Secondary() int {
+ switch ce & ceTypeMask {
+ case ceType1:
+ return int(uint8(ce))
+ case ceType2:
+ return minCompactSecondary + int((ce>>compactSecondaryShift)&0xF)
+ case ceType3or4:
+ if ce < ceType4 {
+ return defaultSecondary
+ }
+ return int(ce>>8) & 0xFFF
+ case ceTypeQ:
+ return 0
+ }
+ panic("should not reach here")
+}
+
+// Tertiary returns the tertiary collation weight for ce.
+func (ce Elem) Tertiary() uint8 {
+ if ce&hasTertiaryMask == 0 {
+ if ce&ceType3or4 == 0 {
+ return uint8(ce & 0x1F)
+ }
+ if ce&ceType4 == ceType4 {
+ return uint8(ce)
+ }
+ return uint8(ce>>24) & 0x1F // type 2
+ } else if ce&ceTypeMask == ceType1 {
+ return defaultTertiary
+ }
+ // ce is a quaternary value.
+ return 0
+}
+
+func (ce Elem) updateTertiary(t uint8) Elem {
+ if ce&ceTypeMask == ceType1 {
+ // convert to type 4
+ nce := ce & primaryValueMask
+ nce |= Elem(uint8(ce)-minCompactSecondary) << compactSecondaryShift
+ ce = nce
+ } else if ce&ceTypeMaskExt == ceType3or4 {
+ ce &= ^Elem(maxTertiary << 24)
+ return ce | (Elem(t) << 24)
+ } else {
+ // type 2 or 4
+ ce &= ^Elem(maxTertiary)
+ }
+ return ce | Elem(t)
+}
+
+// Quaternary returns the quaternary value if explicitly specified,
+// 0 if ce == Ignore, or MaxQuaternary otherwise.
+// Quaternary values are used only for shifted variants.
+func (ce Elem) Quaternary() int {
+ if ce&ceTypeMask == ceTypeQ {
+ return int(ce&primaryValueMask) >> primaryShift
+ } else if ce&ceIgnoreMask == Ignore {
+ return 0
+ }
+ return MaxQuaternary
+}
+
+// Weight returns the collation weight for the given level.
+func (ce Elem) Weight(l Level) int {
+ switch l {
+ case Primary:
+ return ce.Primary()
+ case Secondary:
+ return ce.Secondary()
+ case Tertiary:
+ return int(ce.Tertiary())
+ case Quaternary:
+ return ce.Quaternary()
+ }
+ return 0 // return 0 (ignore) for undefined levels.
+}
+
+// For contractions, collation elements are of the form
+// 110bbbbb bbbbbbbb iiiiiiii iiiinnnn, where
+// - n* is the size of the first node in the contraction trie.
+// - i* is the index of the first node in the contraction trie.
+// - b* is the offset into the contraction collation element table.
+// See contract.go for details on the contraction trie.
+const (
+ maxNBits = 4
+ maxTrieIndexBits = 12
+ maxContractOffsetBits = 13
+)
+
+func splitContractIndex(ce Elem) (index, n, offset int) {
+ n = int(ce & (1<<maxNBits - 1))
+ ce >>= maxNBits
+ index = int(ce & (1<<maxTrieIndexBits - 1))
+ ce >>= maxTrieIndexBits
+ offset = int(ce & (1<<maxContractOffsetBits - 1))
+ return
+}
+
+// For expansions, Elems are of the form 11100000 00000000 bbbbbbbb bbbbbbbb,
+// where b* is the index into the expansion sequence table.
+const maxExpandIndexBits = 16
+
+func splitExpandIndex(ce Elem) (index int) {
+ return int(uint16(ce))
+}
+
+// Some runes can be expanded using NFKD decomposition. Instead of storing the full
+// sequence of collation elements, we decompose the rune and lookup the collation
+// elements for each rune in the decomposition and modify the tertiary weights.
+// The Elem, in this case, is of the form 11110000 00000000 wwwwwwww vvvvvvvv, where
+// - v* is the replacement tertiary weight for the first rune,
+// - w* is the replacement tertiary weight for the second rune,
+// Tertiary weights of subsequent runes should be replaced with maxTertiary.
+// See https://www.unicode.org/reports/tr10/#Compatibility_Decompositions for more details.
+func splitDecompose(ce Elem) (t1, t2 uint8) {
+ return uint8(ce), uint8(ce >> 8)
+}
+
+const (
+ // These constants were taken from https://www.unicode.org/versions/Unicode6.0.0/ch12.pdf.
+ minUnified rune = 0x4E00
+ maxUnified = 0x9FFF
+ minCompatibility = 0xF900
+ maxCompatibility = 0xFAFF
+ minRare = 0x3400
+ maxRare = 0x4DBF
+)
+const (
+ commonUnifiedOffset = 0x10000
+ rareUnifiedOffset = 0x20000 // largest rune in common is U+FAFF
+ otherOffset = 0x50000 // largest rune in rare is U+2FA1D
+ illegalOffset = otherOffset + int(unicode.MaxRune)
+ maxPrimary = illegalOffset + 1
+)
+
+// implicitPrimary returns the primary weight for the a rune
+// for which there is no entry for the rune in the collation table.
+// We take a different approach from the one specified in
+// https://unicode.org/reports/tr10/#Implicit_Weights,
+// but preserve the resulting relative ordering of the runes.
+func implicitPrimary(r rune) int {
+ if unicode.Is(unicode.Ideographic, r) {
+ if r >= minUnified && r <= maxUnified {
+ // The most common case for CJK.
+ return int(r) + commonUnifiedOffset
+ }
+ if r >= minCompatibility && r <= maxCompatibility {
+ // This will typically not hit. The DUCET explicitly specifies mappings
+ // for all characters that do not decompose.
+ return int(r) + commonUnifiedOffset
+ }
+ return int(r) + rareUnifiedOffset
+ }
+ return int(r) + otherOffset
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/colltab.go b/src/dma/vendor/golang.org/x/text/internal/colltab/colltab.go
new file mode 100644
index 00000000..02f22477
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/colltab.go
@@ -0,0 +1,105 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package colltab contains functionality related to collation tables.
+// It is only to be used by the collate and search packages.
+package colltab // import "golang.org/x/text/internal/colltab"
+
+import (
+ "sort"
+
+ "golang.org/x/text/language"
+)
+
+// MatchLang finds the index of t in tags, using a matching algorithm used for
+// collation and search. tags[0] must be language.Und, the remaining tags should
+// be sorted alphabetically.
+//
+// Language matching for collation and search is different from the matching
+// defined by language.Matcher: the (inferred) base language must be an exact
+// match for the relevant fields. For example, "gsw" should not match "de".
+// Also the parent relation is different, as a parent may have a different
+// script. So usually the parent of zh-Hant is und, whereas for MatchLang it is
+// zh.
+func MatchLang(t language.Tag, tags []language.Tag) int {
+ // Canonicalize the values, including collapsing macro languages.
+ t, _ = language.All.Canonicalize(t)
+
+ base, conf := t.Base()
+ // Estimate the base language, but only use high-confidence values.
+ if conf < language.High {
+ // The root locale supports "search" and "standard". We assume that any
+ // implementation will only use one of both.
+ return 0
+ }
+
+ // Maximize base and script and normalize the tag.
+ if _, s, r := t.Raw(); (r != language.Region{}) {
+ p, _ := language.Raw.Compose(base, s, r)
+ // Taking the parent forces the script to be maximized.
+ p = p.Parent()
+ // Add back region and extensions.
+ t, _ = language.Raw.Compose(p, r, t.Extensions())
+ } else {
+ // Set the maximized base language.
+ t, _ = language.Raw.Compose(base, s, t.Extensions())
+ }
+
+ // Find start index of the language tag.
+ start := 1 + sort.Search(len(tags)-1, func(i int) bool {
+ b, _, _ := tags[i+1].Raw()
+ return base.String() <= b.String()
+ })
+ if start < len(tags) {
+ if b, _, _ := tags[start].Raw(); b != base {
+ return 0
+ }
+ }
+
+ // Besides the base language, script and region, only the collation type and
+ // the custom variant defined in the 'u' extension are used to distinguish a
+ // locale.
+ // Strip all variants and extensions and add back the custom variant.
+ tdef, _ := language.Raw.Compose(t.Raw())
+ tdef, _ = tdef.SetTypeForKey("va", t.TypeForKey("va"))
+
+ // First search for a specialized collation type, if present.
+ try := []language.Tag{tdef}
+ if co := t.TypeForKey("co"); co != "" {
+ tco, _ := tdef.SetTypeForKey("co", co)
+ try = []language.Tag{tco, tdef}
+ }
+
+ for _, tx := range try {
+ for ; tx != language.Und; tx = parent(tx) {
+ for i, t := range tags[start:] {
+ if b, _, _ := t.Raw(); b != base {
+ break
+ }
+ if tx == t {
+ return start + i
+ }
+ }
+ }
+ }
+ return 0
+}
+
+// parent computes the structural parent. This means inheritance may change
+// script. So, unlike the CLDR parent, parent(zh-Hant) == zh.
+func parent(t language.Tag) language.Tag {
+ if t.TypeForKey("va") != "" {
+ t, _ = t.SetTypeForKey("va", "")
+ return t
+ }
+ result := language.Und
+ if b, s, r := t.Raw(); (r != language.Region{}) {
+ result, _ = language.Raw.Compose(b, s, t.Extensions())
+ } else if (s != language.Script{}) {
+ result, _ = language.Raw.Compose(b, t.Extensions())
+ } else if (b != language.Base{}) {
+ result, _ = language.Raw.Compose(t.Extensions())
+ }
+ return result
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/contract.go b/src/dma/vendor/golang.org/x/text/internal/colltab/contract.go
new file mode 100644
index 00000000..25649d4f
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/contract.go
@@ -0,0 +1,145 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import "unicode/utf8"
+
+// For a description of ContractTrieSet, see text/collate/build/contract.go.
+
+type ContractTrieSet []struct{ L, H, N, I uint8 }
+
+// ctScanner is used to match a trie to an input sequence.
+// A contraction may match a non-contiguous sequence of bytes in an input string.
+// For example, if there is a contraction for <a, combining_ring>, it should match
+// the sequence <a, combining_cedilla, combining_ring>, as combining_cedilla does
+// not block combining_ring.
+// ctScanner does not automatically skip over non-blocking non-starters, but rather
+// retains the state of the last match and leaves it up to the user to continue
+// the match at the appropriate points.
+type ctScanner struct {
+ states ContractTrieSet
+ s []byte
+ n int
+ index int
+ pindex int
+ done bool
+}
+
+type ctScannerString struct {
+ states ContractTrieSet
+ s string
+ n int
+ index int
+ pindex int
+ done bool
+}
+
+func (t ContractTrieSet) scanner(index, n int, b []byte) ctScanner {
+ return ctScanner{s: b, states: t[index:], n: n}
+}
+
+func (t ContractTrieSet) scannerString(index, n int, str string) ctScannerString {
+ return ctScannerString{s: str, states: t[index:], n: n}
+}
+
+// result returns the offset i and bytes consumed p so far. If no suffix
+// matched, i and p will be 0.
+func (s *ctScanner) result() (i, p int) {
+ return s.index, s.pindex
+}
+
+func (s *ctScannerString) result() (i, p int) {
+ return s.index, s.pindex
+}
+
+const (
+ final = 0
+ noIndex = 0xFF
+)
+
+// scan matches the longest suffix at the current location in the input
+// and returns the number of bytes consumed.
+func (s *ctScanner) scan(p int) int {
+ pr := p // the p at the rune start
+ str := s.s
+ states, n := s.states, s.n
+ for i := 0; i < n && p < len(str); {
+ e := states[i]
+ c := str[p]
+ // TODO: a significant number of contractions are of a form that
+ // cannot match discontiguous UTF-8 in a normalized string. We could let
+ // a negative value of e.n mean that we can set s.done = true and avoid
+ // the need for additional matches.
+ if c >= e.L {
+ if e.L == c {
+ p++
+ if e.I != noIndex {
+ s.index = int(e.I)
+ s.pindex = p
+ }
+ if e.N != final {
+ i, states, n = 0, states[int(e.H)+n:], int(e.N)
+ if p >= len(str) || utf8.RuneStart(str[p]) {
+ s.states, s.n, pr = states, n, p
+ }
+ } else {
+ s.done = true
+ return p
+ }
+ continue
+ } else if e.N == final && c <= e.H {
+ p++
+ s.done = true
+ s.index = int(c-e.L) + int(e.I)
+ s.pindex = p
+ return p
+ }
+ }
+ i++
+ }
+ return pr
+}
+
+// scan is a verbatim copy of ctScanner.scan.
+func (s *ctScannerString) scan(p int) int {
+ pr := p // the p at the rune start
+ str := s.s
+ states, n := s.states, s.n
+ for i := 0; i < n && p < len(str); {
+ e := states[i]
+ c := str[p]
+ // TODO: a significant number of contractions are of a form that
+ // cannot match discontiguous UTF-8 in a normalized string. We could let
+ // a negative value of e.n mean that we can set s.done = true and avoid
+ // the need for additional matches.
+ if c >= e.L {
+ if e.L == c {
+ p++
+ if e.I != noIndex {
+ s.index = int(e.I)
+ s.pindex = p
+ }
+ if e.N != final {
+ i, states, n = 0, states[int(e.H)+n:], int(e.N)
+ if p >= len(str) || utf8.RuneStart(str[p]) {
+ s.states, s.n, pr = states, n, p
+ }
+ } else {
+ s.done = true
+ return p
+ }
+ continue
+ } else if e.N == final && c <= e.H {
+ p++
+ s.done = true
+ s.index = int(c-e.L) + int(e.I)
+ s.pindex = p
+ return p
+ }
+ }
+ i++
+ }
+ return pr
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/iter.go b/src/dma/vendor/golang.org/x/text/internal/colltab/iter.go
new file mode 100644
index 00000000..c1b1ba81
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/iter.go
@@ -0,0 +1,178 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+// An Iter incrementally converts chunks of the input text to collation
+// elements, while ensuring that the collation elements are in normalized order
+// (that is, they are in the order as if the input text were normalized first).
+type Iter struct {
+ Weighter Weighter
+ Elems []Elem
+ // N is the number of elements in Elems that will not be reordered on
+ // subsequent iterations, N <= len(Elems).
+ N int
+
+ bytes []byte
+ str string
+ // Because the Elems buffer may contain collation elements that are needed
+ // for look-ahead, we need two positions in the text (bytes or str): one for
+ // the end position in the text for the current iteration and one for the
+ // start of the next call to appendNext.
+ pEnd int // end position in text corresponding to N.
+ pNext int // pEnd <= pNext.
+}
+
+// Reset sets the position in the current input text to p and discards any
+// results obtained so far.
+func (i *Iter) Reset(p int) {
+ i.Elems = i.Elems[:0]
+ i.N = 0
+ i.pEnd = p
+ i.pNext = p
+}
+
+// Len returns the length of the input text.
+func (i *Iter) Len() int {
+ if i.bytes != nil {
+ return len(i.bytes)
+ }
+ return len(i.str)
+}
+
+// Discard removes the collation elements up to N.
+func (i *Iter) Discard() {
+ // TODO: change this such that only modifiers following starters will have
+ // to be copied.
+ i.Elems = i.Elems[:copy(i.Elems, i.Elems[i.N:])]
+ i.N = 0
+}
+
+// End returns the end position of the input text for which Next has returned
+// results.
+func (i *Iter) End() int {
+ return i.pEnd
+}
+
+// SetInput resets i to input s.
+func (i *Iter) SetInput(s []byte) {
+ i.bytes = s
+ i.str = ""
+ i.Reset(0)
+}
+
+// SetInputString resets i to input s.
+func (i *Iter) SetInputString(s string) {
+ i.str = s
+ i.bytes = nil
+ i.Reset(0)
+}
+
+func (i *Iter) done() bool {
+ return i.pNext >= len(i.str) && i.pNext >= len(i.bytes)
+}
+
+func (i *Iter) appendNext() bool {
+ if i.done() {
+ return false
+ }
+ var sz int
+ if i.bytes == nil {
+ i.Elems, sz = i.Weighter.AppendNextString(i.Elems, i.str[i.pNext:])
+ } else {
+ i.Elems, sz = i.Weighter.AppendNext(i.Elems, i.bytes[i.pNext:])
+ }
+ if sz == 0 {
+ sz = 1
+ }
+ i.pNext += sz
+ return true
+}
+
+// Next appends Elems to the internal array. On each iteration, it will either
+// add starters or modifiers. In the majority of cases, an Elem with a primary
+// value > 0 will have a CCC of 0. The CCC values of collation elements are also
+// used to detect if the input string was not normalized and to adjust the
+// result accordingly.
+func (i *Iter) Next() bool {
+ if i.N == len(i.Elems) && !i.appendNext() {
+ return false
+ }
+
+ // Check if the current segment starts with a starter.
+ prevCCC := i.Elems[len(i.Elems)-1].CCC()
+ if prevCCC == 0 {
+ i.N = len(i.Elems)
+ i.pEnd = i.pNext
+ return true
+ } else if i.Elems[i.N].CCC() == 0 {
+ // set i.N to only cover part of i.Elems for which prevCCC == 0 and
+ // use rest for the next call to next.
+ for i.N++; i.N < len(i.Elems) && i.Elems[i.N].CCC() == 0; i.N++ {
+ }
+ i.pEnd = i.pNext
+ return true
+ }
+
+ // The current (partial) segment starts with modifiers. We need to collect
+ // all successive modifiers to ensure that they are normalized.
+ for {
+ p := len(i.Elems)
+ i.pEnd = i.pNext
+ if !i.appendNext() {
+ break
+ }
+
+ if ccc := i.Elems[p].CCC(); ccc == 0 || len(i.Elems)-i.N > maxCombiningCharacters {
+ // Leave the starter for the next iteration. This ensures that we
+ // do not return sequences of collation elements that cross two
+ // segments.
+ //
+ // TODO: handle large number of combining characters by fully
+ // normalizing the input segment before iteration. This ensures
+ // results are consistent across the text repo.
+ i.N = p
+ return true
+ } else if ccc < prevCCC {
+ i.doNorm(p, ccc) // should be rare, never occurs for NFD and FCC.
+ } else {
+ prevCCC = ccc
+ }
+ }
+
+ done := len(i.Elems) != i.N
+ i.N = len(i.Elems)
+ return done
+}
+
+// nextNoNorm is the same as next, but does not "normalize" the collation
+// elements.
+func (i *Iter) nextNoNorm() bool {
+ // TODO: remove this function. Using this instead of next does not seem
+ // to improve performance in any significant way. We retain this until
+ // later for evaluation purposes.
+ if i.done() {
+ return false
+ }
+ i.appendNext()
+ i.N = len(i.Elems)
+ return true
+}
+
+const maxCombiningCharacters = 30
+
+// doNorm reorders the collation elements in i.Elems.
+// It assumes that blocks of collation elements added with appendNext
+// either start and end with the same CCC or start with CCC == 0.
+// This allows for a single insertion point for the entire block.
+// The correctness of this assumption is verified in builder.go.
+func (i *Iter) doNorm(p int, ccc uint8) {
+ n := len(i.Elems)
+ k := p
+ for p--; p > i.N && ccc < i.Elems[p-1].CCC(); p-- {
+ }
+ i.Elems = append(i.Elems, i.Elems[p:k]...)
+ copy(i.Elems[p:], i.Elems[k:])
+ i.Elems = i.Elems[:n]
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/numeric.go b/src/dma/vendor/golang.org/x/text/internal/colltab/numeric.go
new file mode 100644
index 00000000..53b819cc
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/numeric.go
@@ -0,0 +1,236 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import (
+ "unicode"
+ "unicode/utf8"
+)
+
+// NewNumericWeighter wraps w to replace individual digits to sort based on their
+// numeric value.
+//
+// Weighter w must have a free primary weight after the primary weight for 9.
+// If this is not the case, numeric value will sort at the same primary level
+// as the first primary sorting after 9.
+func NewNumericWeighter(w Weighter) Weighter {
+ getElem := func(s string) Elem {
+ elems, _ := w.AppendNextString(nil, s)
+ return elems[0]
+ }
+ nine := getElem("9")
+
+ // Numbers should order before zero, but the DUCET has no room for this.
+ // TODO: move before zero once we use fractional collation elements.
+ ns, _ := MakeElem(nine.Primary()+1, nine.Secondary(), int(nine.Tertiary()), 0)
+
+ return &numericWeighter{
+ Weighter: w,
+
+ // We assume that w sorts digits of different kinds in order of numeric
+ // value and that the tertiary weight order is preserved.
+ //
+ // TODO: evaluate whether it is worth basing the ranges on the Elem
+ // encoding itself once the move to fractional weights is complete.
+ zero: getElem("0"),
+ zeroSpecialLo: getElem("0"), // U+FF10 FULLWIDTH DIGIT ZERO
+ zeroSpecialHi: getElem("₀"), // U+2080 SUBSCRIPT ZERO
+ nine: nine,
+ nineSpecialHi: getElem("₉"), // U+2089 SUBSCRIPT NINE
+ numberStart: ns,
+ }
+}
+
+// A numericWeighter translates a stream of digits into a stream of weights
+// representing the numeric value.
+type numericWeighter struct {
+ Weighter
+
+ // The Elems below all demarcate boundaries of specific ranges. With the
+ // current element encoding digits are in two ranges: normal (default
+ // tertiary value) and special. For most languages, digits have collation
+ // elements in the normal range.
+ //
+ // Note: the range tests are very specific for the element encoding used by
+ // this implementation. The tests in collate_test.go are designed to fail
+ // if this code is not updated when an encoding has changed.
+
+ zero Elem // normal digit zero
+ zeroSpecialLo Elem // special digit zero, low tertiary value
+ zeroSpecialHi Elem // special digit zero, high tertiary value
+ nine Elem // normal digit nine
+ nineSpecialHi Elem // special digit nine
+ numberStart Elem
+}
+
+// AppendNext calls the namesake of the underlying weigher, but replaces single
+// digits with weights representing their value.
+func (nw *numericWeighter) AppendNext(buf []Elem, s []byte) (ce []Elem, n int) {
+ ce, n = nw.Weighter.AppendNext(buf, s)
+ nc := numberConverter{
+ elems: buf,
+ w: nw,
+ b: s,
+ }
+ isZero, ok := nc.checkNextDigit(ce)
+ if !ok {
+ return ce, n
+ }
+ // ce might have been grown already, so take it instead of buf.
+ nc.init(ce, len(buf), isZero)
+ for n < len(s) {
+ ce, sz := nw.Weighter.AppendNext(nc.elems, s[n:])
+ nc.b = s
+ n += sz
+ if !nc.update(ce) {
+ break
+ }
+ }
+ return nc.result(), n
+}
+
+// AppendNextString calls the namesake of the underlying weigher, but replaces
+// single digits with weights representing their value.
+func (nw *numericWeighter) AppendNextString(buf []Elem, s string) (ce []Elem, n int) {
+ ce, n = nw.Weighter.AppendNextString(buf, s)
+ nc := numberConverter{
+ elems: buf,
+ w: nw,
+ s: s,
+ }
+ isZero, ok := nc.checkNextDigit(ce)
+ if !ok {
+ return ce, n
+ }
+ nc.init(ce, len(buf), isZero)
+ for n < len(s) {
+ ce, sz := nw.Weighter.AppendNextString(nc.elems, s[n:])
+ nc.s = s
+ n += sz
+ if !nc.update(ce) {
+ break
+ }
+ }
+ return nc.result(), n
+}
+
+type numberConverter struct {
+ w *numericWeighter
+
+ elems []Elem
+ nDigits int
+ lenIndex int
+
+ s string // set if the input was of type string
+ b []byte // set if the input was of type []byte
+}
+
+// init completes initialization of a numberConverter and prepares it for adding
+// more digits. elems is assumed to have a digit starting at oldLen.
+func (nc *numberConverter) init(elems []Elem, oldLen int, isZero bool) {
+ // Insert a marker indicating the start of a number and a placeholder
+ // for the number of digits.
+ if isZero {
+ elems = append(elems[:oldLen], nc.w.numberStart, 0)
+ } else {
+ elems = append(elems, 0, 0)
+ copy(elems[oldLen+2:], elems[oldLen:])
+ elems[oldLen] = nc.w.numberStart
+ elems[oldLen+1] = 0
+
+ nc.nDigits = 1
+ }
+ nc.elems = elems
+ nc.lenIndex = oldLen + 1
+}
+
+// checkNextDigit reports whether bufNew adds a single digit relative to the old
+// buffer. If it does, it also reports whether this digit is zero.
+func (nc *numberConverter) checkNextDigit(bufNew []Elem) (isZero, ok bool) {
+ if len(nc.elems) >= len(bufNew) {
+ return false, false
+ }
+ e := bufNew[len(nc.elems)]
+ if e < nc.w.zeroSpecialLo || nc.w.nine < e {
+ // Not a number.
+ return false, false
+ }
+ if e < nc.w.zero {
+ if e > nc.w.nineSpecialHi {
+ // Not a number.
+ return false, false
+ }
+ if !nc.isDigit() {
+ return false, false
+ }
+ isZero = e <= nc.w.zeroSpecialHi
+ } else {
+ // This is the common case if we encounter a digit.
+ isZero = e == nc.w.zero
+ }
+ // Test the remaining added collation elements have a zero primary value.
+ if n := len(bufNew) - len(nc.elems); n > 1 {
+ for i := len(nc.elems) + 1; i < len(bufNew); i++ {
+ if bufNew[i].Primary() != 0 {
+ return false, false
+ }
+ }
+ // In some rare cases, collation elements will encode runes in
+ // unicode.No as a digit. For example Ethiopic digits (U+1369 - U+1371)
+ // are not in Nd. Also some digits that clearly belong in unicode.No,
+ // like U+0C78 TELUGU FRACTION DIGIT ZERO FOR ODD POWERS OF FOUR, have
+ // collation elements indistinguishable from normal digits.
+ // Unfortunately, this means we need to make this check for nearly all
+ // non-Latin digits.
+ //
+ // TODO: check the performance impact and find something better if it is
+ // an issue.
+ if !nc.isDigit() {
+ return false, false
+ }
+ }
+ return isZero, true
+}
+
+func (nc *numberConverter) isDigit() bool {
+ if nc.b != nil {
+ r, _ := utf8.DecodeRune(nc.b)
+ return unicode.In(r, unicode.Nd)
+ }
+ r, _ := utf8.DecodeRuneInString(nc.s)
+ return unicode.In(r, unicode.Nd)
+}
+
+// We currently support a maximum of about 2M digits (the number of primary
+// values). Such numbers will compare correctly against small numbers, but their
+// comparison against other large numbers is undefined.
+//
+// TODO: define a proper fallback, such as comparing large numbers textually or
+// actually allowing numbers of unlimited length.
+//
+// TODO: cap this to a lower number (like 100) and maybe allow a larger number
+// in an option?
+const maxDigits = 1<<maxPrimaryBits - 1
+
+func (nc *numberConverter) update(elems []Elem) bool {
+ isZero, ok := nc.checkNextDigit(elems)
+ if nc.nDigits == 0 && isZero {
+ return true
+ }
+ nc.elems = elems
+ if !ok {
+ return false
+ }
+ nc.nDigits++
+ return nc.nDigits < maxDigits
+}
+
+// result fills in the length element for the digit sequence and returns the
+// completed collation elements.
+func (nc *numberConverter) result() []Elem {
+ e, _ := MakeElem(nc.nDigits, defaultSecondary, defaultTertiary, 0)
+ nc.elems[nc.lenIndex] = e
+ return nc.elems
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/table.go b/src/dma/vendor/golang.org/x/text/internal/colltab/table.go
new file mode 100644
index 00000000..e26e36da
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/table.go
@@ -0,0 +1,275 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab
+
+import (
+ "unicode/utf8"
+
+ "golang.org/x/text/unicode/norm"
+)
+
+// Table holds all collation data for a given collation ordering.
+type Table struct {
+ Index Trie // main trie
+
+ // expansion info
+ ExpandElem []uint32
+
+ // contraction info
+ ContractTries ContractTrieSet
+ ContractElem []uint32
+ MaxContractLen int
+ VariableTop uint32
+}
+
+func (t *Table) AppendNext(w []Elem, b []byte) (res []Elem, n int) {
+ return t.appendNext(w, source{bytes: b})
+}
+
+func (t *Table) AppendNextString(w []Elem, s string) (res []Elem, n int) {
+ return t.appendNext(w, source{str: s})
+}
+
+func (t *Table) Start(p int, b []byte) int {
+ // TODO: implement
+ panic("not implemented")
+}
+
+func (t *Table) StartString(p int, s string) int {
+ // TODO: implement
+ panic("not implemented")
+}
+
+func (t *Table) Domain() []string {
+ // TODO: implement
+ panic("not implemented")
+}
+
+func (t *Table) Top() uint32 {
+ return t.VariableTop
+}
+
+type source struct {
+ str string
+ bytes []byte
+}
+
+func (src *source) lookup(t *Table) (ce Elem, sz int) {
+ if src.bytes == nil {
+ return t.Index.lookupString(src.str)
+ }
+ return t.Index.lookup(src.bytes)
+}
+
+func (src *source) tail(sz int) {
+ if src.bytes == nil {
+ src.str = src.str[sz:]
+ } else {
+ src.bytes = src.bytes[sz:]
+ }
+}
+
+func (src *source) nfd(buf []byte, end int) []byte {
+ if src.bytes == nil {
+ return norm.NFD.AppendString(buf[:0], src.str[:end])
+ }
+ return norm.NFD.Append(buf[:0], src.bytes[:end]...)
+}
+
+func (src *source) rune() (r rune, sz int) {
+ if src.bytes == nil {
+ return utf8.DecodeRuneInString(src.str)
+ }
+ return utf8.DecodeRune(src.bytes)
+}
+
+func (src *source) properties(f norm.Form) norm.Properties {
+ if src.bytes == nil {
+ return f.PropertiesString(src.str)
+ }
+ return f.Properties(src.bytes)
+}
+
+// appendNext appends the weights corresponding to the next rune or
+// contraction in s. If a contraction is matched to a discontinuous
+// sequence of runes, the weights for the interstitial runes are
+// appended as well. It returns a new slice that includes the appended
+// weights and the number of bytes consumed from s.
+func (t *Table) appendNext(w []Elem, src source) (res []Elem, n int) {
+ ce, sz := src.lookup(t)
+ tp := ce.ctype()
+ if tp == ceNormal {
+ if ce == 0 {
+ r, _ := src.rune()
+ const (
+ hangulSize = 3
+ firstHangul = 0xAC00
+ lastHangul = 0xD7A3
+ )
+ if r >= firstHangul && r <= lastHangul {
+ // TODO: performance can be considerably improved here.
+ n = sz
+ var buf [16]byte // Used for decomposing Hangul.
+ for b := src.nfd(buf[:0], hangulSize); len(b) > 0; b = b[sz:] {
+ ce, sz = t.Index.lookup(b)
+ w = append(w, ce)
+ }
+ return w, n
+ }
+ ce = makeImplicitCE(implicitPrimary(r))
+ }
+ w = append(w, ce)
+ } else if tp == ceExpansionIndex {
+ w = t.appendExpansion(w, ce)
+ } else if tp == ceContractionIndex {
+ n := 0
+ src.tail(sz)
+ if src.bytes == nil {
+ w, n = t.matchContractionString(w, ce, src.str)
+ } else {
+ w, n = t.matchContraction(w, ce, src.bytes)
+ }
+ sz += n
+ } else if tp == ceDecompose {
+ // Decompose using NFKD and replace tertiary weights.
+ t1, t2 := splitDecompose(ce)
+ i := len(w)
+ nfkd := src.properties(norm.NFKD).Decomposition()
+ for p := 0; len(nfkd) > 0; nfkd = nfkd[p:] {
+ w, p = t.appendNext(w, source{bytes: nfkd})
+ }
+ w[i] = w[i].updateTertiary(t1)
+ if i++; i < len(w) {
+ w[i] = w[i].updateTertiary(t2)
+ for i++; i < len(w); i++ {
+ w[i] = w[i].updateTertiary(maxTertiary)
+ }
+ }
+ }
+ return w, sz
+}
+
+func (t *Table) appendExpansion(w []Elem, ce Elem) []Elem {
+ i := splitExpandIndex(ce)
+ n := int(t.ExpandElem[i])
+ i++
+ for _, ce := range t.ExpandElem[i : i+n] {
+ w = append(w, Elem(ce))
+ }
+ return w
+}
+
+func (t *Table) matchContraction(w []Elem, ce Elem, suffix []byte) ([]Elem, int) {
+ index, n, offset := splitContractIndex(ce)
+
+ scan := t.ContractTries.scanner(index, n, suffix)
+ buf := [norm.MaxSegmentSize]byte{}
+ bufp := 0
+ p := scan.scan(0)
+
+ if !scan.done && p < len(suffix) && suffix[p] >= utf8.RuneSelf {
+ // By now we should have filtered most cases.
+ p0 := p
+ bufn := 0
+ rune := norm.NFD.Properties(suffix[p:])
+ p += rune.Size()
+ if rune.LeadCCC() != 0 {
+ prevCC := rune.TrailCCC()
+ // A gap may only occur in the last normalization segment.
+ // This also ensures that len(scan.s) < norm.MaxSegmentSize.
+ if end := norm.NFD.FirstBoundary(suffix[p:]); end != -1 {
+ scan.s = suffix[:p+end]
+ }
+ for p < len(suffix) && !scan.done && suffix[p] >= utf8.RuneSelf {
+ rune = norm.NFD.Properties(suffix[p:])
+ if ccc := rune.LeadCCC(); ccc == 0 || prevCC >= ccc {
+ break
+ }
+ prevCC = rune.TrailCCC()
+ if pp := scan.scan(p); pp != p {
+ // Copy the interstitial runes for later processing.
+ bufn += copy(buf[bufn:], suffix[p0:p])
+ if scan.pindex == pp {
+ bufp = bufn
+ }
+ p, p0 = pp, pp
+ } else {
+ p += rune.Size()
+ }
+ }
+ }
+ }
+ // Append weights for the matched contraction, which may be an expansion.
+ i, n := scan.result()
+ ce = Elem(t.ContractElem[i+offset])
+ if ce.ctype() == ceNormal {
+ w = append(w, ce)
+ } else {
+ w = t.appendExpansion(w, ce)
+ }
+ // Append weights for the runes in the segment not part of the contraction.
+ for b, p := buf[:bufp], 0; len(b) > 0; b = b[p:] {
+ w, p = t.appendNext(w, source{bytes: b})
+ }
+ return w, n
+}
+
+// TODO: unify the two implementations. This is best done after first simplifying
+// the algorithm taking into account the inclusion of both NFC and NFD forms
+// in the table.
+func (t *Table) matchContractionString(w []Elem, ce Elem, suffix string) ([]Elem, int) {
+ index, n, offset := splitContractIndex(ce)
+
+ scan := t.ContractTries.scannerString(index, n, suffix)
+ buf := [norm.MaxSegmentSize]byte{}
+ bufp := 0
+ p := scan.scan(0)
+
+ if !scan.done && p < len(suffix) && suffix[p] >= utf8.RuneSelf {
+ // By now we should have filtered most cases.
+ p0 := p
+ bufn := 0
+ rune := norm.NFD.PropertiesString(suffix[p:])
+ p += rune.Size()
+ if rune.LeadCCC() != 0 {
+ prevCC := rune.TrailCCC()
+ // A gap may only occur in the last normalization segment.
+ // This also ensures that len(scan.s) < norm.MaxSegmentSize.
+ if end := norm.NFD.FirstBoundaryInString(suffix[p:]); end != -1 {
+ scan.s = suffix[:p+end]
+ }
+ for p < len(suffix) && !scan.done && suffix[p] >= utf8.RuneSelf {
+ rune = norm.NFD.PropertiesString(suffix[p:])
+ if ccc := rune.LeadCCC(); ccc == 0 || prevCC >= ccc {
+ break
+ }
+ prevCC = rune.TrailCCC()
+ if pp := scan.scan(p); pp != p {
+ // Copy the interstitial runes for later processing.
+ bufn += copy(buf[bufn:], suffix[p0:p])
+ if scan.pindex == pp {
+ bufp = bufn
+ }
+ p, p0 = pp, pp
+ } else {
+ p += rune.Size()
+ }
+ }
+ }
+ }
+ // Append weights for the matched contraction, which may be an expansion.
+ i, n := scan.result()
+ ce = Elem(t.ContractElem[i+offset])
+ if ce.ctype() == ceNormal {
+ w = append(w, ce)
+ } else {
+ w = t.appendExpansion(w, ce)
+ }
+ // Append weights for the runes in the segment not part of the contraction.
+ for b, p := buf[:bufp], 0; len(b) > 0; b = b[p:] {
+ w, p = t.appendNext(w, source{bytes: b})
+ }
+ return w, n
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/trie.go b/src/dma/vendor/golang.org/x/text/internal/colltab/trie.go
new file mode 100644
index 00000000..a0eaa0d2
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/trie.go
@@ -0,0 +1,159 @@
+// Copyright 2012 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// The trie in this file is used to associate the first full character in an
+// UTF-8 string to a collation element. All but the last byte in a UTF-8 byte
+// sequence are used to lookup offsets in the index table to be used for the
+// next byte. The last byte is used to index into a table of collation elements.
+// For a full description, see go.text/collate/build/trie.go.
+
+package colltab
+
+const blockSize = 64
+
+type Trie struct {
+ Index0 []uint16 // index for first byte (0xC0-0xFF)
+ Values0 []uint32 // index for first byte (0x00-0x7F)
+ Index []uint16
+ Values []uint32
+}
+
+const (
+ t1 = 0x00 // 0000 0000
+ tx = 0x80 // 1000 0000
+ t2 = 0xC0 // 1100 0000
+ t3 = 0xE0 // 1110 0000
+ t4 = 0xF0 // 1111 0000
+ t5 = 0xF8 // 1111 1000
+ t6 = 0xFC // 1111 1100
+ te = 0xFE // 1111 1110
+)
+
+func (t *Trie) lookupValue(n uint16, b byte) Elem {
+ return Elem(t.Values[int(n)<<6+int(b)])
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *Trie) lookup(s []byte) (v Elem, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < tx:
+ return Elem(t.Values0[c0]), 1
+ case c0 < t2:
+ return 0, 1
+ case c0 < t3:
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := t.Index0[c0]
+ c1 := s[1]
+ if c1 < tx || t2 <= c1 {
+ return 0, 1
+ }
+ return t.lookupValue(i, c1), 2
+ case c0 < t4:
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := t.Index0[c0]
+ c1 := s[1]
+ if c1 < tx || t2 <= c1 {
+ return 0, 1
+ }
+ o := int(i)<<6 + int(c1)
+ i = t.Index[o]
+ c2 := s[2]
+ if c2 < tx || t2 <= c2 {
+ return 0, 2
+ }
+ return t.lookupValue(i, c2), 3
+ case c0 < t5:
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := t.Index0[c0]
+ c1 := s[1]
+ if c1 < tx || t2 <= c1 {
+ return 0, 1
+ }
+ o := int(i)<<6 + int(c1)
+ i = t.Index[o]
+ c2 := s[2]
+ if c2 < tx || t2 <= c2 {
+ return 0, 2
+ }
+ o = int(i)<<6 + int(c2)
+ i = t.Index[o]
+ c3 := s[3]
+ if c3 < tx || t2 <= c3 {
+ return 0, 3
+ }
+ return t.lookupValue(i, c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// The body of lookupString is a verbatim copy of that of lookup.
+func (t *Trie) lookupString(s string) (v Elem, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < tx:
+ return Elem(t.Values0[c0]), 1
+ case c0 < t2:
+ return 0, 1
+ case c0 < t3:
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := t.Index0[c0]
+ c1 := s[1]
+ if c1 < tx || t2 <= c1 {
+ return 0, 1
+ }
+ return t.lookupValue(i, c1), 2
+ case c0 < t4:
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := t.Index0[c0]
+ c1 := s[1]
+ if c1 < tx || t2 <= c1 {
+ return 0, 1
+ }
+ o := int(i)<<6 + int(c1)
+ i = t.Index[o]
+ c2 := s[2]
+ if c2 < tx || t2 <= c2 {
+ return 0, 2
+ }
+ return t.lookupValue(i, c2), 3
+ case c0 < t5:
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := t.Index0[c0]
+ c1 := s[1]
+ if c1 < tx || t2 <= c1 {
+ return 0, 1
+ }
+ o := int(i)<<6 + int(c1)
+ i = t.Index[o]
+ c2 := s[2]
+ if c2 < tx || t2 <= c2 {
+ return 0, 2
+ }
+ o = int(i)<<6 + int(c2)
+ i = t.Index[o]
+ c3 := s[3]
+ if c3 < tx || t2 <= c3 {
+ return 0, 3
+ }
+ return t.lookupValue(i, c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/colltab/weighter.go b/src/dma/vendor/golang.org/x/text/internal/colltab/weighter.go
new file mode 100644
index 00000000..f1ec45fb
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/colltab/weighter.go
@@ -0,0 +1,31 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package colltab // import "golang.org/x/text/internal/colltab"
+
+// A Weighter can be used as a source for Collator and Searcher.
+type Weighter interface {
+ // Start finds the start of the segment that includes position p.
+ Start(p int, b []byte) int
+
+ // StartString finds the start of the segment that includes position p.
+ StartString(p int, s string) int
+
+ // AppendNext appends Elems to buf corresponding to the longest match
+ // of a single character or contraction from the start of s.
+ // It returns the new buf and the number of bytes consumed.
+ AppendNext(buf []Elem, s []byte) (ce []Elem, n int)
+
+ // AppendNextString appends Elems to buf corresponding to the longest match
+ // of a single character or contraction from the start of s.
+ // It returns the new buf and the number of bytes consumed.
+ AppendNextString(buf []Elem, s string) (ce []Elem, n int)
+
+ // Domain returns a slice of all single characters and contractions for which
+ // collation elements are defined in this table.
+ Domain() []string
+
+ // Top returns the highest variable primary value.
+ Top() uint32
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/gen/code.go b/src/dma/vendor/golang.org/x/text/internal/gen/code.go
new file mode 100644
index 00000000..75435c9b
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/gen/code.go
@@ -0,0 +1,375 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package gen
+
+import (
+ "bytes"
+ "encoding/gob"
+ "fmt"
+ "hash"
+ "hash/fnv"
+ "io"
+ "log"
+ "os"
+ "reflect"
+ "strings"
+ "unicode"
+ "unicode/utf8"
+)
+
+// This file contains utilities for generating code.
+
+// TODO: other write methods like:
+// - slices, maps, types, etc.
+
+// CodeWriter is a utility for writing structured code. It computes the content
+// hash and size of written content. It ensures there are newlines between
+// written code blocks.
+type CodeWriter struct {
+ buf bytes.Buffer
+ Size int
+ Hash hash.Hash32 // content hash
+ gob *gob.Encoder
+ // For comments we skip the usual one-line separator if they are followed by
+ // a code block.
+ skipSep bool
+}
+
+func (w *CodeWriter) Write(p []byte) (n int, err error) {
+ return w.buf.Write(p)
+}
+
+// NewCodeWriter returns a new CodeWriter.
+func NewCodeWriter() *CodeWriter {
+ h := fnv.New32()
+ return &CodeWriter{Hash: h, gob: gob.NewEncoder(h)}
+}
+
+// WriteGoFile appends the buffer with the total size of all created structures
+// and writes it as a Go file to the given file with the given package name.
+func (w *CodeWriter) WriteGoFile(filename, pkg string) {
+ f, err := os.Create(filename)
+ if err != nil {
+ log.Fatalf("Could not create file %s: %v", filename, err)
+ }
+ defer f.Close()
+ if _, err = w.WriteGo(f, pkg, ""); err != nil {
+ log.Fatalf("Error writing file %s: %v", filename, err)
+ }
+}
+
+// WriteVersionedGoFile appends the buffer with the total size of all created
+// structures and writes it as a Go file to the given file with the given
+// package name and build tags for the current Unicode version,
+func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) {
+ tags := buildTags()
+ if tags != "" {
+ pattern := fileToPattern(filename)
+ updateBuildTags(pattern)
+ filename = fmt.Sprintf(pattern, UnicodeVersion())
+ }
+ f, err := os.Create(filename)
+ if err != nil {
+ log.Fatalf("Could not create file %s: %v", filename, err)
+ }
+ defer f.Close()
+ if _, err = w.WriteGo(f, pkg, tags); err != nil {
+ log.Fatalf("Error writing file %s: %v", filename, err)
+ }
+}
+
+// WriteGo appends the buffer with the total size of all created structures and
+// writes it as a Go file to the given writer with the given package name.
+func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) {
+ sz := w.Size
+ if sz > 0 {
+ w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
+ }
+ defer w.buf.Reset()
+ return WriteGo(out, pkg, tags, w.buf.Bytes())
+}
+
+func (w *CodeWriter) printf(f string, x ...interface{}) {
+ fmt.Fprintf(w, f, x...)
+}
+
+func (w *CodeWriter) insertSep() {
+ if w.skipSep {
+ w.skipSep = false
+ return
+ }
+ // Use at least two newlines to ensure a blank space between the previous
+ // block. WriteGoFile will remove extraneous newlines.
+ w.printf("\n\n")
+}
+
+// WriteComment writes a comment block. All line starts are prefixed with "//".
+// Initial empty lines are gobbled. The indentation for the first line is
+// stripped from consecutive lines.
+func (w *CodeWriter) WriteComment(comment string, args ...interface{}) {
+ s := fmt.Sprintf(comment, args...)
+ s = strings.Trim(s, "\n")
+
+ // Use at least two newlines to ensure a blank space between the previous
+ // block. WriteGoFile will remove extraneous newlines.
+ w.printf("\n\n// ")
+ w.skipSep = true
+
+ // strip first indent level.
+ sep := "\n"
+ for ; len(s) > 0 && (s[0] == '\t' || s[0] == ' '); s = s[1:] {
+ sep += s[:1]
+ }
+
+ strings.NewReplacer(sep, "\n// ", "\n", "\n// ").WriteString(w, s)
+
+ w.printf("\n")
+}
+
+func (w *CodeWriter) writeSizeInfo(size int) {
+ w.printf("// Size: %d bytes\n", size)
+}
+
+// WriteConst writes a constant of the given name and value.
+func (w *CodeWriter) WriteConst(name string, x interface{}) {
+ w.insertSep()
+ v := reflect.ValueOf(x)
+
+ switch v.Type().Kind() {
+ case reflect.String:
+ w.printf("const %s %s = ", name, typeName(x))
+ w.WriteString(v.String())
+ w.printf("\n")
+ default:
+ w.printf("const %s = %#v\n", name, x)
+ }
+}
+
+// WriteVar writes a variable of the given name and value.
+func (w *CodeWriter) WriteVar(name string, x interface{}) {
+ w.insertSep()
+ v := reflect.ValueOf(x)
+ oldSize := w.Size
+ sz := int(v.Type().Size())
+ w.Size += sz
+
+ switch v.Type().Kind() {
+ case reflect.String:
+ w.printf("var %s %s = ", name, typeName(x))
+ w.WriteString(v.String())
+ case reflect.Struct:
+ w.gob.Encode(x)
+ fallthrough
+ case reflect.Slice, reflect.Array:
+ w.printf("var %s = ", name)
+ w.writeValue(v)
+ w.writeSizeInfo(w.Size - oldSize)
+ default:
+ w.printf("var %s %s = ", name, typeName(x))
+ w.gob.Encode(x)
+ w.writeValue(v)
+ w.writeSizeInfo(w.Size - oldSize)
+ }
+ w.printf("\n")
+}
+
+func (w *CodeWriter) writeValue(v reflect.Value) {
+ x := v.Interface()
+ switch v.Kind() {
+ case reflect.String:
+ w.WriteString(v.String())
+ case reflect.Array:
+ // Don't double count: callers of WriteArray count on the size being
+ // added, so we need to discount it here.
+ w.Size -= int(v.Type().Size())
+ w.writeSlice(x, true)
+ case reflect.Slice:
+ w.writeSlice(x, false)
+ case reflect.Struct:
+ w.printf("%s{\n", typeName(v.Interface()))
+ t := v.Type()
+ for i := 0; i < v.NumField(); i++ {
+ w.printf("%s: ", t.Field(i).Name)
+ w.writeValue(v.Field(i))
+ w.printf(",\n")
+ }
+ w.printf("}")
+ default:
+ w.printf("%#v", x)
+ }
+}
+
+// WriteString writes a string literal.
+func (w *CodeWriter) WriteString(s string) {
+ io.WriteString(w.Hash, s) // content hash
+ w.Size += len(s)
+
+ const maxInline = 40
+ if len(s) <= maxInline {
+ w.printf("%q", s)
+ return
+ }
+
+ // We will render the string as a multi-line string.
+ const maxWidth = 80 - 4 - len(`"`) - len(`" +`)
+
+ // When starting on its own line, go fmt indents line 2+ an extra level.
+ n, max := maxWidth, maxWidth-4
+
+ // As per https://golang.org/issue/18078, the compiler has trouble
+ // compiling the concatenation of many strings, s0 + s1 + s2 + ... + sN,
+ // for large N. We insert redundant, explicit parentheses to work around
+ // that, lowering the N at any given step: (s0 + s1 + ... + s63) + (s64 +
+ // ... + s127) + etc + (etc + ... + sN).
+ explicitParens, extraComment := len(s) > 128*1024, ""
+ if explicitParens {
+ w.printf(`(`)
+ extraComment = "; the redundant, explicit parens are for https://golang.org/issue/18078"
+ }
+
+ // Print "" +\n, if a string does not start on its own line.
+ b := w.buf.Bytes()
+ if p := len(bytes.TrimRight(b, " \t")); p > 0 && b[p-1] != '\n' {
+ w.printf("\"\" + // Size: %d bytes%s\n", len(s), extraComment)
+ n, max = maxWidth, maxWidth
+ }
+
+ w.printf(`"`)
+
+ for sz, p, nLines := 0, 0, 0; p < len(s); {
+ var r rune
+ r, sz = utf8.DecodeRuneInString(s[p:])
+ out := s[p : p+sz]
+ chars := 1
+ if !unicode.IsPrint(r) || r == utf8.RuneError || r == '"' {
+ switch sz {
+ case 1:
+ out = fmt.Sprintf("\\x%02x", s[p])
+ case 2, 3:
+ out = fmt.Sprintf("\\u%04x", r)
+ case 4:
+ out = fmt.Sprintf("\\U%08x", r)
+ }
+ chars = len(out)
+ } else if r == '\\' {
+ out = "\\" + string(r)
+ chars = 2
+ }
+ if n -= chars; n < 0 {
+ nLines++
+ if explicitParens && nLines&63 == 63 {
+ w.printf("\") + (\"")
+ }
+ w.printf("\" +\n\"")
+ n = max - len(out)
+ }
+ w.printf("%s", out)
+ p += sz
+ }
+ w.printf(`"`)
+ if explicitParens {
+ w.printf(`)`)
+ }
+}
+
+// WriteSlice writes a slice value.
+func (w *CodeWriter) WriteSlice(x interface{}) {
+ w.writeSlice(x, false)
+}
+
+// WriteArray writes an array value.
+func (w *CodeWriter) WriteArray(x interface{}) {
+ w.writeSlice(x, true)
+}
+
+func (w *CodeWriter) writeSlice(x interface{}, isArray bool) {
+ v := reflect.ValueOf(x)
+ w.gob.Encode(v.Len())
+ w.Size += v.Len() * int(v.Type().Elem().Size())
+ name := typeName(x)
+ if isArray {
+ name = fmt.Sprintf("[%d]%s", v.Len(), name[strings.Index(name, "]")+1:])
+ }
+ if isArray {
+ w.printf("%s{\n", name)
+ } else {
+ w.printf("%s{ // %d elements\n", name, v.Len())
+ }
+
+ switch kind := v.Type().Elem().Kind(); kind {
+ case reflect.String:
+ for _, s := range x.([]string) {
+ w.WriteString(s)
+ w.printf(",\n")
+ }
+ case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64,
+ reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
+ // nLine and nBlock are the number of elements per line and block.
+ nLine, nBlock, format := 8, 64, "%d,"
+ switch kind {
+ case reflect.Uint8:
+ format = "%#02x,"
+ case reflect.Uint16:
+ format = "%#04x,"
+ case reflect.Uint32:
+ nLine, nBlock, format = 4, 32, "%#08x,"
+ case reflect.Uint, reflect.Uint64:
+ nLine, nBlock, format = 4, 32, "%#016x,"
+ case reflect.Int8:
+ nLine = 16
+ }
+ n := nLine
+ for i := 0; i < v.Len(); i++ {
+ if i%nBlock == 0 && v.Len() > nBlock {
+ w.printf("// Entry %X - %X\n", i, i+nBlock-1)
+ }
+ x := v.Index(i).Interface()
+ w.gob.Encode(x)
+ w.printf(format, x)
+ if n--; n == 0 {
+ n = nLine
+ w.printf("\n")
+ }
+ }
+ w.printf("\n")
+ case reflect.Struct:
+ zero := reflect.Zero(v.Type().Elem()).Interface()
+ for i := 0; i < v.Len(); i++ {
+ x := v.Index(i).Interface()
+ w.gob.EncodeValue(v)
+ if !reflect.DeepEqual(zero, x) {
+ line := fmt.Sprintf("%#v,\n", x)
+ line = line[strings.IndexByte(line, '{'):]
+ w.printf("%d: ", i)
+ w.printf(line)
+ }
+ }
+ case reflect.Array:
+ for i := 0; i < v.Len(); i++ {
+ w.printf("%d: %#v,\n", i, v.Index(i).Interface())
+ }
+ default:
+ panic("gen: slice elem type not supported")
+ }
+ w.printf("}")
+}
+
+// WriteType writes a definition of the type of the given value and returns the
+// type name.
+func (w *CodeWriter) WriteType(x interface{}) string {
+ t := reflect.TypeOf(x)
+ w.printf("type %s struct {\n", t.Name())
+ for i := 0; i < t.NumField(); i++ {
+ w.printf("\t%s %s\n", t.Field(i).Name, t.Field(i).Type)
+ }
+ w.printf("}\n")
+ return t.Name()
+}
+
+// typeName returns the name of the go type of x.
+func typeName(x interface{}) string {
+ t := reflect.ValueOf(x).Type()
+ return strings.Replace(fmt.Sprint(t), "main.", "", 1)
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/gen/gen.go b/src/dma/vendor/golang.org/x/text/internal/gen/gen.go
new file mode 100644
index 00000000..cc6510fd
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/gen/gen.go
@@ -0,0 +1,347 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package gen contains common code for the various code generation tools in the
+// text repository. Its usage ensures consistency between tools.
+//
+// This package defines command line flags that are common to most generation
+// tools. The flags allow for specifying specific Unicode and CLDR versions
+// in the public Unicode data repository (https://www.unicode.org/Public).
+//
+// A local Unicode data mirror can be set through the flag -local or the
+// environment variable UNICODE_DIR. The former takes precedence. The local
+// directory should follow the same structure as the public repository.
+//
+// IANA data can also optionally be mirrored by putting it in the iana directory
+// rooted at the top of the local mirror. Beware, though, that IANA data is not
+// versioned. So it is up to the developer to use the right version.
+package gen // import "golang.org/x/text/internal/gen"
+
+import (
+ "bytes"
+ "flag"
+ "fmt"
+ "go/build"
+ "go/format"
+ "io"
+ "io/ioutil"
+ "log"
+ "net/http"
+ "os"
+ "path"
+ "path/filepath"
+ "regexp"
+ "strings"
+ "sync"
+ "unicode"
+
+ "golang.org/x/text/unicode/cldr"
+)
+
+var (
+ url = flag.String("url",
+ "https://www.unicode.org/Public",
+ "URL of Unicode database directory")
+ iana = flag.String("iana",
+ "http://www.iana.org",
+ "URL of the IANA repository")
+ unicodeVersion = flag.String("unicode",
+ getEnv("UNICODE_VERSION", unicode.Version),
+ "unicode version to use")
+ cldrVersion = flag.String("cldr",
+ getEnv("CLDR_VERSION", cldr.Version),
+ "cldr version to use")
+)
+
+func getEnv(name, def string) string {
+ if v := os.Getenv(name); v != "" {
+ return v
+ }
+ return def
+}
+
+// Init performs common initialization for a gen command. It parses the flags
+// and sets up the standard logging parameters.
+func Init() {
+ log.SetPrefix("")
+ log.SetFlags(log.Lshortfile)
+ flag.Parse()
+}
+
+const header = `// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+`
+
+// UnicodeVersion reports the requested Unicode version.
+func UnicodeVersion() string {
+ return *unicodeVersion
+}
+
+// CLDRVersion reports the requested CLDR version.
+func CLDRVersion() string {
+ return *cldrVersion
+}
+
+var tags = []struct{ version, buildTags string }{
+ {"9.0.0", "!go1.10"},
+ {"10.0.0", "go1.10,!go1.13"},
+ {"11.0.0", "go1.13"},
+}
+
+// buildTags reports the build tags used for the current Unicode version.
+func buildTags() string {
+ v := UnicodeVersion()
+ for _, e := range tags {
+ if e.version == v {
+ return e.buildTags
+ }
+ }
+ log.Fatalf("Unknown build tags for Unicode version %q.", v)
+ return ""
+}
+
+// IsLocal reports whether data files are available locally.
+func IsLocal() bool {
+ dir, err := localReadmeFile()
+ if err != nil {
+ return false
+ }
+ if _, err = os.Stat(dir); err != nil {
+ return false
+ }
+ return true
+}
+
+// OpenUCDFile opens the requested UCD file. The file is specified relative to
+// the public Unicode root directory. It will call log.Fatal if there are any
+// errors.
+func OpenUCDFile(file string) io.ReadCloser {
+ return openUnicode(path.Join(*unicodeVersion, "ucd", file))
+}
+
+// OpenCLDRCoreZip opens the CLDR core zip file. It will call log.Fatal if there
+// are any errors.
+func OpenCLDRCoreZip() io.ReadCloser {
+ return OpenUnicodeFile("cldr", *cldrVersion, "core.zip")
+}
+
+// OpenUnicodeFile opens the requested file of the requested category from the
+// root of the Unicode data archive. The file is specified relative to the
+// public Unicode root directory. If version is "", it will use the default
+// Unicode version. It will call log.Fatal if there are any errors.
+func OpenUnicodeFile(category, version, file string) io.ReadCloser {
+ if version == "" {
+ version = UnicodeVersion()
+ }
+ return openUnicode(path.Join(category, version, file))
+}
+
+// OpenIANAFile opens the requested IANA file. The file is specified relative
+// to the IANA root, which is typically either http://www.iana.org or the
+// iana directory in the local mirror. It will call log.Fatal if there are any
+// errors.
+func OpenIANAFile(path string) io.ReadCloser {
+ return Open(*iana, "iana", path)
+}
+
+var (
+ dirMutex sync.Mutex
+ localDir string
+)
+
+const permissions = 0755
+
+func localReadmeFile() (string, error) {
+ p, err := build.Import("golang.org/x/text", "", build.FindOnly)
+ if err != nil {
+ return "", fmt.Errorf("Could not locate package: %v", err)
+ }
+ return filepath.Join(p.Dir, "DATA", "README"), nil
+}
+
+func getLocalDir() string {
+ dirMutex.Lock()
+ defer dirMutex.Unlock()
+
+ readme, err := localReadmeFile()
+ if err != nil {
+ log.Fatal(err)
+ }
+ dir := filepath.Dir(readme)
+ if _, err := os.Stat(readme); err != nil {
+ if err := os.MkdirAll(dir, permissions); err != nil {
+ log.Fatalf("Could not create directory: %v", err)
+ }
+ ioutil.WriteFile(readme, []byte(readmeTxt), permissions)
+ }
+ return dir
+}
+
+const readmeTxt = `Generated by golang.org/x/text/internal/gen. DO NOT EDIT.
+
+This directory contains downloaded files used to generate the various tables
+in the golang.org/x/text subrepo.
+
+Note that the language subtag repo (iana/assignments/language-subtag-registry)
+and all other times in the iana subdirectory are not versioned and will need
+to be periodically manually updated. The easiest way to do this is to remove
+the entire iana directory. This is mostly of concern when updating the language
+package.
+`
+
+// Open opens subdir/path if a local directory is specified and the file exists,
+// where subdir is a directory relative to the local root, or fetches it from
+// urlRoot/path otherwise. It will call log.Fatal if there are any errors.
+func Open(urlRoot, subdir, path string) io.ReadCloser {
+ file := filepath.Join(getLocalDir(), subdir, filepath.FromSlash(path))
+ return open(file, urlRoot, path)
+}
+
+func openUnicode(path string) io.ReadCloser {
+ file := filepath.Join(getLocalDir(), filepath.FromSlash(path))
+ return open(file, *url, path)
+}
+
+// TODO: automatically periodically update non-versioned files.
+
+func open(file, urlRoot, path string) io.ReadCloser {
+ if f, err := os.Open(file); err == nil {
+ return f
+ }
+ r := get(urlRoot, path)
+ defer r.Close()
+ b, err := ioutil.ReadAll(r)
+ if err != nil {
+ log.Fatalf("Could not download file: %v", err)
+ }
+ os.MkdirAll(filepath.Dir(file), permissions)
+ if err := ioutil.WriteFile(file, b, permissions); err != nil {
+ log.Fatalf("Could not create file: %v", err)
+ }
+ return ioutil.NopCloser(bytes.NewReader(b))
+}
+
+func get(root, path string) io.ReadCloser {
+ url := root + "/" + path
+ fmt.Printf("Fetching %s...", url)
+ defer fmt.Println(" done.")
+ resp, err := http.Get(url)
+ if err != nil {
+ log.Fatalf("HTTP GET: %v", err)
+ }
+ if resp.StatusCode != 200 {
+ log.Fatalf("Bad GET status for %q: %q", url, resp.Status)
+ }
+ return resp.Body
+}
+
+// TODO: use Write*Version in all applicable packages.
+
+// WriteUnicodeVersion writes a constant for the Unicode version from which the
+// tables are generated.
+func WriteUnicodeVersion(w io.Writer) {
+ fmt.Fprintf(w, "// UnicodeVersion is the Unicode version from which the tables in this package are derived.\n")
+ fmt.Fprintf(w, "const UnicodeVersion = %q\n\n", UnicodeVersion())
+}
+
+// WriteCLDRVersion writes a constant for the CLDR version from which the
+// tables are generated.
+func WriteCLDRVersion(w io.Writer) {
+ fmt.Fprintf(w, "// CLDRVersion is the CLDR version from which the tables in this package are derived.\n")
+ fmt.Fprintf(w, "const CLDRVersion = %q\n\n", CLDRVersion())
+}
+
+// WriteGoFile prepends a standard file comment and package statement to the
+// given bytes, applies gofmt, and writes them to a file with the given name.
+// It will call log.Fatal if there are any errors.
+func WriteGoFile(filename, pkg string, b []byte) {
+ w, err := os.Create(filename)
+ if err != nil {
+ log.Fatalf("Could not create file %s: %v", filename, err)
+ }
+ defer w.Close()
+ if _, err = WriteGo(w, pkg, "", b); err != nil {
+ log.Fatalf("Error writing file %s: %v", filename, err)
+ }
+}
+
+func fileToPattern(filename string) string {
+ suffix := ".go"
+ if strings.HasSuffix(filename, "_test.go") {
+ suffix = "_test.go"
+ }
+ prefix := filename[:len(filename)-len(suffix)]
+ return fmt.Sprint(prefix, "%s", suffix)
+}
+
+func updateBuildTags(pattern string) {
+ for _, t := range tags {
+ oldFile := fmt.Sprintf(pattern, t.version)
+ b, err := ioutil.ReadFile(oldFile)
+ if err != nil {
+ continue
+ }
+ build := fmt.Sprintf("// +build %s", t.buildTags)
+ b = regexp.MustCompile(`// \+build .*`).ReplaceAll(b, []byte(build))
+ err = ioutil.WriteFile(oldFile, b, 0644)
+ if err != nil {
+ log.Fatal(err)
+ }
+ }
+}
+
+// WriteVersionedGoFile prepends a standard file comment, adds build tags to
+// version the file for the current Unicode version, and package statement to
+// the given bytes, applies gofmt, and writes them to a file with the given
+// name. It will call log.Fatal if there are any errors.
+func WriteVersionedGoFile(filename, pkg string, b []byte) {
+ pattern := fileToPattern(filename)
+ updateBuildTags(pattern)
+ filename = fmt.Sprintf(pattern, UnicodeVersion())
+
+ w, err := os.Create(filename)
+ if err != nil {
+ log.Fatalf("Could not create file %s: %v", filename, err)
+ }
+ defer w.Close()
+ if _, err = WriteGo(w, pkg, buildTags(), b); err != nil {
+ log.Fatalf("Error writing file %s: %v", filename, err)
+ }
+}
+
+// WriteGo prepends a standard file comment and package statement to the given
+// bytes, applies gofmt, and writes them to w.
+func WriteGo(w io.Writer, pkg, tags string, b []byte) (n int, err error) {
+ src := []byte(header)
+ if tags != "" {
+ src = append(src, fmt.Sprintf("// +build %s\n\n", tags)...)
+ }
+ src = append(src, fmt.Sprintf("package %s\n\n", pkg)...)
+ src = append(src, b...)
+ formatted, err := format.Source(src)
+ if err != nil {
+ // Print the generated code even in case of an error so that the
+ // returned error can be meaningfully interpreted.
+ n, _ = w.Write(src)
+ return n, err
+ }
+ return w.Write(formatted)
+}
+
+// Repackage rewrites a Go file from belonging to package main to belonging to
+// the given package.
+func Repackage(inFile, outFile, pkg string) {
+ src, err := ioutil.ReadFile(inFile)
+ if err != nil {
+ log.Fatalf("reading %s: %v", inFile, err)
+ }
+ const toDelete = "package main\n\n"
+ i := bytes.Index(src, []byte(toDelete))
+ if i < 0 {
+ log.Fatalf("Could not find %q in %s.", toDelete, inFile)
+ }
+ w := &bytes.Buffer{}
+ w.Write(src[i+len(toDelete):])
+ WriteGoFile(outFile, pkg, w.Bytes())
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/common.go b/src/dma/vendor/golang.org/x/text/internal/language/common.go
new file mode 100644
index 00000000..cdfdb749
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+ Deprecated AliasType = iota
+ Macro
+ Legacy
+
+ AliasTypeUnknown AliasType = -1
+)
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact.go b/src/dma/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 00000000..46a00150
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+ if t.LangID > langNoIndexOffset {
+ return 0, false
+ }
+ cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+ cci |= CompactCoreInfo(t.ScriptID) << 12
+ cci |= CompactCoreInfo(t.RegionID)
+ return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+ return Tag{
+ LangID: Language(c >> 20),
+ RegionID: Region(c & 0x3ff),
+ ScriptID: Script(c>>12) & 0xff,
+ }
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/compact.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 00000000..1b36935e
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ return 0, false
+ }
+ i := sort.Search(len(coreTags), func(i int) bool {
+ return cci <= coreTags[i]
+ })
+ if i == len(coreTags) || coreTags[i] != cci {
+ return 0, false
+ }
+ return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+ return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+ if int(id) >= len(coreTags) {
+ return specialTags[int(id)-len(coreTags)]
+ }
+ return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+ tags := strings.Split(specialTagsStr, " ")
+ specialTags = make([]language.Tag, len(tags))
+ for i, t := range tags {
+ specialTags[i] = language.MustParse(t)
+ }
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/gen.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen.go
new file mode 100644
index 00000000..0c36a052
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen.go
@@ -0,0 +1,64 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+ "flag"
+ "fmt"
+ "log"
+
+ "golang.org/x/text/internal/gen"
+ "golang.org/x/text/unicode/cldr"
+)
+
+var (
+ test = flag.Bool("test",
+ false,
+ "test existing tables; can be used to compare web data with package data.")
+ outputFile = flag.String("output",
+ "tables.go",
+ "output file for generated tables")
+)
+
+func main() {
+ gen.Init()
+
+ w := gen.NewCodeWriter()
+ defer w.WriteGoFile("tables.go", "compact")
+
+ fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`)
+
+ b := newBuilder(w)
+ gen.WriteCLDRVersion(w)
+
+ b.writeCompactIndex()
+}
+
+type builder struct {
+ w *gen.CodeWriter
+ data *cldr.CLDR
+ supp *cldr.SupplementalData
+}
+
+func newBuilder(w *gen.CodeWriter) *builder {
+ r := gen.OpenCLDRCoreZip()
+ defer r.Close()
+ d := &cldr.Decoder{}
+ data, err := d.DecodeZip(r)
+ if err != nil {
+ log.Fatal(err)
+ }
+ b := builder{
+ w: w,
+ data: data,
+ supp: data.Supplemental(),
+ }
+ return &b
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_index.go
new file mode 100644
index 00000000..136cefaf
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_index.go
@@ -0,0 +1,113 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file generates derivative tables based on the language package itself.
+
+import (
+ "fmt"
+ "log"
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Compact indices:
+// Note -va-X variants only apply to localization variants.
+// BCP variants only ever apply to language.
+// The only ambiguity between tags is with regions.
+
+func (b *builder) writeCompactIndex() {
+ // Collect all language tags for which we have any data in CLDR.
+ m := map[language.Tag]bool{}
+ for _, lang := range b.data.Locales() {
+ // We include all locales unconditionally to be consistent with en_US.
+ // We want en_US, even though it has no data associated with it.
+
+ // TODO: put any of the languages for which no data exists at the end
+ // of the index. This allows all components based on ICU to use that
+ // as the cutoff point.
+ // if x := data.RawLDML(lang); false ||
+ // x.LocaleDisplayNames != nil ||
+ // x.Characters != nil ||
+ // x.Delimiters != nil ||
+ // x.Measurement != nil ||
+ // x.Dates != nil ||
+ // x.Numbers != nil ||
+ // x.Units != nil ||
+ // x.ListPatterns != nil ||
+ // x.Collations != nil ||
+ // x.Segmentations != nil ||
+ // x.Rbnf != nil ||
+ // x.Annotations != nil ||
+ // x.Metadata != nil {
+
+ // TODO: support POSIX natively, albeit non-standard.
+ tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
+ m[tag] = true
+ // }
+ }
+
+ // TODO: plural rules are also defined for the deprecated tags:
+ // iw mo sh tl
+ // Consider removing these as compact tags.
+
+ // Include locales for plural rules, which uses a different structure.
+ for _, plurals := range b.supp.Plurals {
+ for _, rules := range plurals.PluralRules {
+ for _, lang := range strings.Split(rules.Locales, " ") {
+ m[language.Make(lang)] = true
+ }
+ }
+ }
+
+ var coreTags []language.CompactCoreInfo
+ var special []string
+
+ for t := range m {
+ if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
+ log.Fatalf("Unexpected extension %v in %v", x, t)
+ }
+ if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ log.Fatalf("Locale for non-basic language %q", t)
+ }
+ coreTags = append(coreTags, cci)
+ } else {
+ special = append(special, t.String())
+ }
+ }
+
+ w := b.w
+
+ sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] })
+ sort.Strings(special)
+
+ w.WriteComment(`
+ NumCompactTags is the number of common tags. The maximum tag is
+ NumCompactTags-1.`)
+ w.WriteConst("NumCompactTags", len(m))
+
+ fmt.Fprintln(w, "const (")
+ for i, t := range coreTags {
+ fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i)
+ }
+ for i, t := range special {
+ fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags))
+ }
+ fmt.Fprintln(w, ")")
+
+ w.WriteVar("coreTags", coreTags)
+
+ w.WriteConst("specialTagsStr", strings.Join(special, " "))
+}
+
+func ident(s string) string {
+ return strings.Replace(s, "-", "", -1) + "Index"
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
new file mode 100644
index 00000000..9543d583
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
@@ -0,0 +1,54 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+import (
+ "log"
+
+ "golang.org/x/text/internal/gen"
+ "golang.org/x/text/internal/language"
+ "golang.org/x/text/internal/language/compact"
+ "golang.org/x/text/unicode/cldr"
+)
+
+func main() {
+ r := gen.OpenCLDRCoreZip()
+ defer r.Close()
+
+ d := &cldr.Decoder{}
+ data, err := d.DecodeZip(r)
+ if err != nil {
+ log.Fatalf("DecodeZip: %v", err)
+ }
+
+ w := gen.NewCodeWriter()
+ defer w.WriteGoFile("parents.go", "compact")
+
+ // Create parents table.
+ type ID uint16
+ parents := make([]ID, compact.NumCompactTags)
+ for _, loc := range data.Locales() {
+ tag := language.MustParse(loc)
+ index, ok := compact.FromTag(tag)
+ if !ok {
+ continue
+ }
+ parentIndex := compact.ID(0) // und
+ for p := tag.Parent(); p != language.Und; p = p.Parent() {
+ if x, ok := compact.FromTag(p); ok {
+ parentIndex = x
+ break
+ }
+ }
+ parents[index] = ID(parentIndex)
+ }
+
+ w.WriteComment(`
+ parents maps a compact index of a tag to the compact index of the parent of
+ this tag.`)
+ w.WriteVar("parents", parents)
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/language.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 00000000..83816a72
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+ // NOTE: exported tags will become part of the public API.
+ language ID
+ locale ID
+ full fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+ IsRoot() bool
+ Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+ if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+ if r, err := language.ParseRegion(region[:2]); err == nil {
+ tFull := t
+ t, _ = t.SetTypeForKey("rg", "")
+ // TODO: should we not consider "va" for the language tag?
+ var exact1, exact2 bool
+ tag.language, exact1 = FromTag(t)
+ t.RegionID = r
+ tag.locale, exact2 = FromTag(t)
+ if !exact1 || !exact2 {
+ tag.full = tFull
+ }
+ return tag
+ }
+ }
+ lang, ok := FromTag(t)
+ tag.language = lang
+ tag.locale = lang
+ if !ok {
+ tag.full = t
+ }
+ return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+ if t.full != nil {
+ return t.full.(language.Tag)
+ }
+ tag := t.language.Tag()
+ if t.language != t.locale {
+ loc := t.locale.Tag()
+ tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+ }
+ return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+ return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+ return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+ return t.full != nil ||
+ int(t.language) >= len(coreTags) ||
+ t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if t.full != nil {
+ return t.full.IsRoot()
+ }
+ return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.full != nil {
+ return Make(t.full.Parent())
+ }
+ if t.language != t.locale {
+ // Simulate stripping -u-rg-xxxxxx
+ return Tag{language: t.language, locale: t.language}
+ }
+ // TODO: use parent lookup table once cycle from internal package is
+ // removed. Probably by internalizing the table and declaring this fast
+ // enough.
+ // lang := compactID(internal.Parent(uint16(t.language)))
+ lang, _ := FromTag(t.language.Tag().Parent())
+ return Tag{language: lang, locale: lang}
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+ return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+ return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+ if t.full == nil {
+ return Tag{language: t.language, locale: t.language}
+ }
+ tt := t.Tag()
+ tt.SetTypeForKey("rg", "")
+ tt.SetTypeForKey("va", "")
+ return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+ rt := Tag{language: t.locale, locale: t.locale}
+ if t.full == nil {
+ return rt
+ }
+ b := language.Builder{}
+ tag := t.Tag()
+ // tag, _ = tag.SetTypeForKey("rg", "")
+ b.SetTag(t.locale.Tag())
+ if v := tag.Variants(); v != "" {
+ for _, v := range strings.Split(v, "-") {
+ b.AddVariant(v)
+ }
+ }
+ for _, e := range tag.Extensions() {
+ b.AddExt(e)
+ }
+ return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+ // TODO: perhaps give more frequent tags a lower index.
+ // TODO: we could make the indexes stable. This will excluded some
+ // possibilities for optimization, so don't do this quite yet.
+ exact = true
+
+ b, s, r := t.Raw()
+ if t.HasString() {
+ if t.IsPrivateUse() {
+ // We have no entries for user-defined tags.
+ return 0, false
+ }
+ hasExtra := false
+ if t.HasVariants() {
+ if t.HasExtensions() {
+ build := language.Builder{}
+ build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+ build.AddVariant(t.Variants())
+ exact = false
+ t = build.Make()
+ }
+ hasExtra = true
+ } else if _, ok := t.Extension('u'); ok {
+ // TODO: va may mean something else. Consider not considering it.
+ // Strip all but the 'va' entry.
+ old := t
+ variant := t.TypeForKey("va")
+ t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+ if variant != "" {
+ t, _ = t.SetTypeForKey("va", variant)
+ hasExtra = true
+ }
+ exact = old == t
+ } else {
+ exact = false
+ }
+ if hasExtra {
+ // We have some variants.
+ for i, s := range specialTags {
+ if s == t {
+ return ID(i + len(coreTags)), exact
+ }
+ }
+ exact = false
+ }
+ }
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ exact = false
+ if r != 0 && s == 0 {
+ // Deal with cases where an extra script is inserted for the region.
+ t, _ := t.Maximize()
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ for t = t.Parent(); t != root; t = t.Parent() {
+ // No variants specified: just compare core components.
+ // The key has the form lllssrrr, where l, s, and r are nibbles for
+ // respectively the langID, scriptID, and regionID.
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/parents.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 00000000..8d810723
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+ // Entry 0 - 3F
+ 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+ 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+ 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+ 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+ 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+ // Entry 40 - 7F
+ 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+ 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+ 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+ 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+ 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+ 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+ 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+ 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+ // Entry 80 - BF
+ 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+ // Entry C0 - FF
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+ 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+ 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+ // Entry 100 - 13F
+ 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+ 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+ 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+ 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ // Entry 140 - 17F
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+ 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+ 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+ 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+ 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+ 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+ // Entry 180 - 1BF
+ 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+ 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+ 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+ 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+ 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+ 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+ 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+ 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+ // Entry 1C0 - 1FF
+ 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+ 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+ 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+ 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+ 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+ 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+ 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+ 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+ // Entry 200 - 23F
+ 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+ 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+ 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+ 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+ 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+ 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+ 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+ 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+ // Entry 240 - 27F
+ 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+ 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+ 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+ 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+ 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+ 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+ 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+ 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+ // Entry 280 - 2BF
+ 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+ 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+ 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+ 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+ 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+ 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+ 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+ 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+ // Entry 2C0 - 2FF
+ 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+ 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+ 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+ 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+ 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+ 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+ 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+ 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+ // Entry 300 - 33F
+ 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/tables.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 00000000..554ca354
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+ undIndex ID = 0
+ afIndex ID = 1
+ afNAIndex ID = 2
+ afZAIndex ID = 3
+ agqIndex ID = 4
+ agqCMIndex ID = 5
+ akIndex ID = 6
+ akGHIndex ID = 7
+ amIndex ID = 8
+ amETIndex ID = 9
+ arIndex ID = 10
+ ar001Index ID = 11
+ arAEIndex ID = 12
+ arBHIndex ID = 13
+ arDJIndex ID = 14
+ arDZIndex ID = 15
+ arEGIndex ID = 16
+ arEHIndex ID = 17
+ arERIndex ID = 18
+ arILIndex ID = 19
+ arIQIndex ID = 20
+ arJOIndex ID = 21
+ arKMIndex ID = 22
+ arKWIndex ID = 23
+ arLBIndex ID = 24
+ arLYIndex ID = 25
+ arMAIndex ID = 26
+ arMRIndex ID = 27
+ arOMIndex ID = 28
+ arPSIndex ID = 29
+ arQAIndex ID = 30
+ arSAIndex ID = 31
+ arSDIndex ID = 32
+ arSOIndex ID = 33
+ arSSIndex ID = 34
+ arSYIndex ID = 35
+ arTDIndex ID = 36
+ arTNIndex ID = 37
+ arYEIndex ID = 38
+ arsIndex ID = 39
+ asIndex ID = 40
+ asINIndex ID = 41
+ asaIndex ID = 42
+ asaTZIndex ID = 43
+ astIndex ID = 44
+ astESIndex ID = 45
+ azIndex ID = 46
+ azCyrlIndex ID = 47
+ azCyrlAZIndex ID = 48
+ azLatnIndex ID = 49
+ azLatnAZIndex ID = 50
+ basIndex ID = 51
+ basCMIndex ID = 52
+ beIndex ID = 53
+ beBYIndex ID = 54
+ bemIndex ID = 55
+ bemZMIndex ID = 56
+ bezIndex ID = 57
+ bezTZIndex ID = 58
+ bgIndex ID = 59
+ bgBGIndex ID = 60
+ bhIndex ID = 61
+ bmIndex ID = 62
+ bmMLIndex ID = 63
+ bnIndex ID = 64
+ bnBDIndex ID = 65
+ bnINIndex ID = 66
+ boIndex ID = 67
+ boCNIndex ID = 68
+ boINIndex ID = 69
+ brIndex ID = 70
+ brFRIndex ID = 71
+ brxIndex ID = 72
+ brxINIndex ID = 73
+ bsIndex ID = 74
+ bsCyrlIndex ID = 75
+ bsCyrlBAIndex ID = 76
+ bsLatnIndex ID = 77
+ bsLatnBAIndex ID = 78
+ caIndex ID = 79
+ caADIndex ID = 80
+ caESIndex ID = 81
+ caFRIndex ID = 82
+ caITIndex ID = 83
+ ccpIndex ID = 84
+ ccpBDIndex ID = 85
+ ccpINIndex ID = 86
+ ceIndex ID = 87
+ ceRUIndex ID = 88
+ cggIndex ID = 89
+ cggUGIndex ID = 90
+ chrIndex ID = 91
+ chrUSIndex ID = 92
+ ckbIndex ID = 93
+ ckbIQIndex ID = 94
+ ckbIRIndex ID = 95
+ csIndex ID = 96
+ csCZIndex ID = 97
+ cuIndex ID = 98
+ cuRUIndex ID = 99
+ cyIndex ID = 100
+ cyGBIndex ID = 101
+ daIndex ID = 102
+ daDKIndex ID = 103
+ daGLIndex ID = 104
+ davIndex ID = 105
+ davKEIndex ID = 106
+ deIndex ID = 107
+ deATIndex ID = 108
+ deBEIndex ID = 109
+ deCHIndex ID = 110
+ deDEIndex ID = 111
+ deITIndex ID = 112
+ deLIIndex ID = 113
+ deLUIndex ID = 114
+ djeIndex ID = 115
+ djeNEIndex ID = 116
+ dsbIndex ID = 117
+ dsbDEIndex ID = 118
+ duaIndex ID = 119
+ duaCMIndex ID = 120
+ dvIndex ID = 121
+ dyoIndex ID = 122
+ dyoSNIndex ID = 123
+ dzIndex ID = 124
+ dzBTIndex ID = 125
+ ebuIndex ID = 126
+ ebuKEIndex ID = 127
+ eeIndex ID = 128
+ eeGHIndex ID = 129
+ eeTGIndex ID = 130
+ elIndex ID = 131
+ elCYIndex ID = 132
+ elGRIndex ID = 133
+ enIndex ID = 134
+ en001Index ID = 135
+ en150Index ID = 136
+ enAGIndex ID = 137
+ enAIIndex ID = 138
+ enASIndex ID = 139
+ enATIndex ID = 140
+ enAUIndex ID = 141
+ enBBIndex ID = 142
+ enBEIndex ID = 143
+ enBIIndex ID = 144
+ enBMIndex ID = 145
+ enBSIndex ID = 146
+ enBWIndex ID = 147
+ enBZIndex ID = 148
+ enCAIndex ID = 149
+ enCCIndex ID = 150
+ enCHIndex ID = 151
+ enCKIndex ID = 152
+ enCMIndex ID = 153
+ enCXIndex ID = 154
+ enCYIndex ID = 155
+ enDEIndex ID = 156
+ enDGIndex ID = 157
+ enDKIndex ID = 158
+ enDMIndex ID = 159
+ enERIndex ID = 160
+ enFIIndex ID = 161
+ enFJIndex ID = 162
+ enFKIndex ID = 163
+ enFMIndex ID = 164
+ enGBIndex ID = 165
+ enGDIndex ID = 166
+ enGGIndex ID = 167
+ enGHIndex ID = 168
+ enGIIndex ID = 169
+ enGMIndex ID = 170
+ enGUIndex ID = 171
+ enGYIndex ID = 172
+ enHKIndex ID = 173
+ enIEIndex ID = 174
+ enILIndex ID = 175
+ enIMIndex ID = 176
+ enINIndex ID = 177
+ enIOIndex ID = 178
+ enJEIndex ID = 179
+ enJMIndex ID = 180
+ enKEIndex ID = 181
+ enKIIndex ID = 182
+ enKNIndex ID = 183
+ enKYIndex ID = 184
+ enLCIndex ID = 185
+ enLRIndex ID = 186
+ enLSIndex ID = 187
+ enMGIndex ID = 188
+ enMHIndex ID = 189
+ enMOIndex ID = 190
+ enMPIndex ID = 191
+ enMSIndex ID = 192
+ enMTIndex ID = 193
+ enMUIndex ID = 194
+ enMWIndex ID = 195
+ enMYIndex ID = 196
+ enNAIndex ID = 197
+ enNFIndex ID = 198
+ enNGIndex ID = 199
+ enNLIndex ID = 200
+ enNRIndex ID = 201
+ enNUIndex ID = 202
+ enNZIndex ID = 203
+ enPGIndex ID = 204
+ enPHIndex ID = 205
+ enPKIndex ID = 206
+ enPNIndex ID = 207
+ enPRIndex ID = 208
+ enPWIndex ID = 209
+ enRWIndex ID = 210
+ enSBIndex ID = 211
+ enSCIndex ID = 212
+ enSDIndex ID = 213
+ enSEIndex ID = 214
+ enSGIndex ID = 215
+ enSHIndex ID = 216
+ enSIIndex ID = 217
+ enSLIndex ID = 218
+ enSSIndex ID = 219
+ enSXIndex ID = 220
+ enSZIndex ID = 221
+ enTCIndex ID = 222
+ enTKIndex ID = 223
+ enTOIndex ID = 224
+ enTTIndex ID = 225
+ enTVIndex ID = 226
+ enTZIndex ID = 227
+ enUGIndex ID = 228
+ enUMIndex ID = 229
+ enUSIndex ID = 230
+ enVCIndex ID = 231
+ enVGIndex ID = 232
+ enVIIndex ID = 233
+ enVUIndex ID = 234
+ enWSIndex ID = 235
+ enZAIndex ID = 236
+ enZMIndex ID = 237
+ enZWIndex ID = 238
+ eoIndex ID = 239
+ eo001Index ID = 240
+ esIndex ID = 241
+ es419Index ID = 242
+ esARIndex ID = 243
+ esBOIndex ID = 244
+ esBRIndex ID = 245
+ esBZIndex ID = 246
+ esCLIndex ID = 247
+ esCOIndex ID = 248
+ esCRIndex ID = 249
+ esCUIndex ID = 250
+ esDOIndex ID = 251
+ esEAIndex ID = 252
+ esECIndex ID = 253
+ esESIndex ID = 254
+ esGQIndex ID = 255
+ esGTIndex ID = 256
+ esHNIndex ID = 257
+ esICIndex ID = 258
+ esMXIndex ID = 259
+ esNIIndex ID = 260
+ esPAIndex ID = 261
+ esPEIndex ID = 262
+ esPHIndex ID = 263
+ esPRIndex ID = 264
+ esPYIndex ID = 265
+ esSVIndex ID = 266
+ esUSIndex ID = 267
+ esUYIndex ID = 268
+ esVEIndex ID = 269
+ etIndex ID = 270
+ etEEIndex ID = 271
+ euIndex ID = 272
+ euESIndex ID = 273
+ ewoIndex ID = 274
+ ewoCMIndex ID = 275
+ faIndex ID = 276
+ faAFIndex ID = 277
+ faIRIndex ID = 278
+ ffIndex ID = 279
+ ffCMIndex ID = 280
+ ffGNIndex ID = 281
+ ffMRIndex ID = 282
+ ffSNIndex ID = 283
+ fiIndex ID = 284
+ fiFIIndex ID = 285
+ filIndex ID = 286
+ filPHIndex ID = 287
+ foIndex ID = 288
+ foDKIndex ID = 289
+ foFOIndex ID = 290
+ frIndex ID = 291
+ frBEIndex ID = 292
+ frBFIndex ID = 293
+ frBIIndex ID = 294
+ frBJIndex ID = 295
+ frBLIndex ID = 296
+ frCAIndex ID = 297
+ frCDIndex ID = 298
+ frCFIndex ID = 299
+ frCGIndex ID = 300
+ frCHIndex ID = 301
+ frCIIndex ID = 302
+ frCMIndex ID = 303
+ frDJIndex ID = 304
+ frDZIndex ID = 305
+ frFRIndex ID = 306
+ frGAIndex ID = 307
+ frGFIndex ID = 308
+ frGNIndex ID = 309
+ frGPIndex ID = 310
+ frGQIndex ID = 311
+ frHTIndex ID = 312
+ frKMIndex ID = 313
+ frLUIndex ID = 314
+ frMAIndex ID = 315
+ frMCIndex ID = 316
+ frMFIndex ID = 317
+ frMGIndex ID = 318
+ frMLIndex ID = 319
+ frMQIndex ID = 320
+ frMRIndex ID = 321
+ frMUIndex ID = 322
+ frNCIndex ID = 323
+ frNEIndex ID = 324
+ frPFIndex ID = 325
+ frPMIndex ID = 326
+ frREIndex ID = 327
+ frRWIndex ID = 328
+ frSCIndex ID = 329
+ frSNIndex ID = 330
+ frSYIndex ID = 331
+ frTDIndex ID = 332
+ frTGIndex ID = 333
+ frTNIndex ID = 334
+ frVUIndex ID = 335
+ frWFIndex ID = 336
+ frYTIndex ID = 337
+ furIndex ID = 338
+ furITIndex ID = 339
+ fyIndex ID = 340
+ fyNLIndex ID = 341
+ gaIndex ID = 342
+ gaIEIndex ID = 343
+ gdIndex ID = 344
+ gdGBIndex ID = 345
+ glIndex ID = 346
+ glESIndex ID = 347
+ gswIndex ID = 348
+ gswCHIndex ID = 349
+ gswFRIndex ID = 350
+ gswLIIndex ID = 351
+ guIndex ID = 352
+ guINIndex ID = 353
+ guwIndex ID = 354
+ guzIndex ID = 355
+ guzKEIndex ID = 356
+ gvIndex ID = 357
+ gvIMIndex ID = 358
+ haIndex ID = 359
+ haGHIndex ID = 360
+ haNEIndex ID = 361
+ haNGIndex ID = 362
+ hawIndex ID = 363
+ hawUSIndex ID = 364
+ heIndex ID = 365
+ heILIndex ID = 366
+ hiIndex ID = 367
+ hiINIndex ID = 368
+ hrIndex ID = 369
+ hrBAIndex ID = 370
+ hrHRIndex ID = 371
+ hsbIndex ID = 372
+ hsbDEIndex ID = 373
+ huIndex ID = 374
+ huHUIndex ID = 375
+ hyIndex ID = 376
+ hyAMIndex ID = 377
+ idIndex ID = 378
+ idIDIndex ID = 379
+ igIndex ID = 380
+ igNGIndex ID = 381
+ iiIndex ID = 382
+ iiCNIndex ID = 383
+ inIndex ID = 384
+ ioIndex ID = 385
+ isIndex ID = 386
+ isISIndex ID = 387
+ itIndex ID = 388
+ itCHIndex ID = 389
+ itITIndex ID = 390
+ itSMIndex ID = 391
+ itVAIndex ID = 392
+ iuIndex ID = 393
+ iwIndex ID = 394
+ jaIndex ID = 395
+ jaJPIndex ID = 396
+ jboIndex ID = 397
+ jgoIndex ID = 398
+ jgoCMIndex ID = 399
+ jiIndex ID = 400
+ jmcIndex ID = 401
+ jmcTZIndex ID = 402
+ jvIndex ID = 403
+ jwIndex ID = 404
+ kaIndex ID = 405
+ kaGEIndex ID = 406
+ kabIndex ID = 407
+ kabDZIndex ID = 408
+ kajIndex ID = 409
+ kamIndex ID = 410
+ kamKEIndex ID = 411
+ kcgIndex ID = 412
+ kdeIndex ID = 413
+ kdeTZIndex ID = 414
+ keaIndex ID = 415
+ keaCVIndex ID = 416
+ khqIndex ID = 417
+ khqMLIndex ID = 418
+ kiIndex ID = 419
+ kiKEIndex ID = 420
+ kkIndex ID = 421
+ kkKZIndex ID = 422
+ kkjIndex ID = 423
+ kkjCMIndex ID = 424
+ klIndex ID = 425
+ klGLIndex ID = 426
+ klnIndex ID = 427
+ klnKEIndex ID = 428
+ kmIndex ID = 429
+ kmKHIndex ID = 430
+ knIndex ID = 431
+ knINIndex ID = 432
+ koIndex ID = 433
+ koKPIndex ID = 434
+ koKRIndex ID = 435
+ kokIndex ID = 436
+ kokINIndex ID = 437
+ ksIndex ID = 438
+ ksINIndex ID = 439
+ ksbIndex ID = 440
+ ksbTZIndex ID = 441
+ ksfIndex ID = 442
+ ksfCMIndex ID = 443
+ kshIndex ID = 444
+ kshDEIndex ID = 445
+ kuIndex ID = 446
+ kwIndex ID = 447
+ kwGBIndex ID = 448
+ kyIndex ID = 449
+ kyKGIndex ID = 450
+ lagIndex ID = 451
+ lagTZIndex ID = 452
+ lbIndex ID = 453
+ lbLUIndex ID = 454
+ lgIndex ID = 455
+ lgUGIndex ID = 456
+ lktIndex ID = 457
+ lktUSIndex ID = 458
+ lnIndex ID = 459
+ lnAOIndex ID = 460
+ lnCDIndex ID = 461
+ lnCFIndex ID = 462
+ lnCGIndex ID = 463
+ loIndex ID = 464
+ loLAIndex ID = 465
+ lrcIndex ID = 466
+ lrcIQIndex ID = 467
+ lrcIRIndex ID = 468
+ ltIndex ID = 469
+ ltLTIndex ID = 470
+ luIndex ID = 471
+ luCDIndex ID = 472
+ luoIndex ID = 473
+ luoKEIndex ID = 474
+ luyIndex ID = 475
+ luyKEIndex ID = 476
+ lvIndex ID = 477
+ lvLVIndex ID = 478
+ masIndex ID = 479
+ masKEIndex ID = 480
+ masTZIndex ID = 481
+ merIndex ID = 482
+ merKEIndex ID = 483
+ mfeIndex ID = 484
+ mfeMUIndex ID = 485
+ mgIndex ID = 486
+ mgMGIndex ID = 487
+ mghIndex ID = 488
+ mghMZIndex ID = 489
+ mgoIndex ID = 490
+ mgoCMIndex ID = 491
+ mkIndex ID = 492
+ mkMKIndex ID = 493
+ mlIndex ID = 494
+ mlINIndex ID = 495
+ mnIndex ID = 496
+ mnMNIndex ID = 497
+ moIndex ID = 498
+ mrIndex ID = 499
+ mrINIndex ID = 500
+ msIndex ID = 501
+ msBNIndex ID = 502
+ msMYIndex ID = 503
+ msSGIndex ID = 504
+ mtIndex ID = 505
+ mtMTIndex ID = 506
+ muaIndex ID = 507
+ muaCMIndex ID = 508
+ myIndex ID = 509
+ myMMIndex ID = 510
+ mznIndex ID = 511
+ mznIRIndex ID = 512
+ nahIndex ID = 513
+ naqIndex ID = 514
+ naqNAIndex ID = 515
+ nbIndex ID = 516
+ nbNOIndex ID = 517
+ nbSJIndex ID = 518
+ ndIndex ID = 519
+ ndZWIndex ID = 520
+ ndsIndex ID = 521
+ ndsDEIndex ID = 522
+ ndsNLIndex ID = 523
+ neIndex ID = 524
+ neINIndex ID = 525
+ neNPIndex ID = 526
+ nlIndex ID = 527
+ nlAWIndex ID = 528
+ nlBEIndex ID = 529
+ nlBQIndex ID = 530
+ nlCWIndex ID = 531
+ nlNLIndex ID = 532
+ nlSRIndex ID = 533
+ nlSXIndex ID = 534
+ nmgIndex ID = 535
+ nmgCMIndex ID = 536
+ nnIndex ID = 537
+ nnNOIndex ID = 538
+ nnhIndex ID = 539
+ nnhCMIndex ID = 540
+ noIndex ID = 541
+ nqoIndex ID = 542
+ nrIndex ID = 543
+ nsoIndex ID = 544
+ nusIndex ID = 545
+ nusSSIndex ID = 546
+ nyIndex ID = 547
+ nynIndex ID = 548
+ nynUGIndex ID = 549
+ omIndex ID = 550
+ omETIndex ID = 551
+ omKEIndex ID = 552
+ orIndex ID = 553
+ orINIndex ID = 554
+ osIndex ID = 555
+ osGEIndex ID = 556
+ osRUIndex ID = 557
+ paIndex ID = 558
+ paArabIndex ID = 559
+ paArabPKIndex ID = 560
+ paGuruIndex ID = 561
+ paGuruINIndex ID = 562
+ papIndex ID = 563
+ plIndex ID = 564
+ plPLIndex ID = 565
+ prgIndex ID = 566
+ prg001Index ID = 567
+ psIndex ID = 568
+ psAFIndex ID = 569
+ ptIndex ID = 570
+ ptAOIndex ID = 571
+ ptBRIndex ID = 572
+ ptCHIndex ID = 573
+ ptCVIndex ID = 574
+ ptGQIndex ID = 575
+ ptGWIndex ID = 576
+ ptLUIndex ID = 577
+ ptMOIndex ID = 578
+ ptMZIndex ID = 579
+ ptPTIndex ID = 580
+ ptSTIndex ID = 581
+ ptTLIndex ID = 582
+ quIndex ID = 583
+ quBOIndex ID = 584
+ quECIndex ID = 585
+ quPEIndex ID = 586
+ rmIndex ID = 587
+ rmCHIndex ID = 588
+ rnIndex ID = 589
+ rnBIIndex ID = 590
+ roIndex ID = 591
+ roMDIndex ID = 592
+ roROIndex ID = 593
+ rofIndex ID = 594
+ rofTZIndex ID = 595
+ ruIndex ID = 596
+ ruBYIndex ID = 597
+ ruKGIndex ID = 598
+ ruKZIndex ID = 599
+ ruMDIndex ID = 600
+ ruRUIndex ID = 601
+ ruUAIndex ID = 602
+ rwIndex ID = 603
+ rwRWIndex ID = 604
+ rwkIndex ID = 605
+ rwkTZIndex ID = 606
+ sahIndex ID = 607
+ sahRUIndex ID = 608
+ saqIndex ID = 609
+ saqKEIndex ID = 610
+ sbpIndex ID = 611
+ sbpTZIndex ID = 612
+ sdIndex ID = 613
+ sdPKIndex ID = 614
+ sdhIndex ID = 615
+ seIndex ID = 616
+ seFIIndex ID = 617
+ seNOIndex ID = 618
+ seSEIndex ID = 619
+ sehIndex ID = 620
+ sehMZIndex ID = 621
+ sesIndex ID = 622
+ sesMLIndex ID = 623
+ sgIndex ID = 624
+ sgCFIndex ID = 625
+ shIndex ID = 626
+ shiIndex ID = 627
+ shiLatnIndex ID = 628
+ shiLatnMAIndex ID = 629
+ shiTfngIndex ID = 630
+ shiTfngMAIndex ID = 631
+ siIndex ID = 632
+ siLKIndex ID = 633
+ skIndex ID = 634
+ skSKIndex ID = 635
+ slIndex ID = 636
+ slSIIndex ID = 637
+ smaIndex ID = 638
+ smiIndex ID = 639
+ smjIndex ID = 640
+ smnIndex ID = 641
+ smnFIIndex ID = 642
+ smsIndex ID = 643
+ snIndex ID = 644
+ snZWIndex ID = 645
+ soIndex ID = 646
+ soDJIndex ID = 647
+ soETIndex ID = 648
+ soKEIndex ID = 649
+ soSOIndex ID = 650
+ sqIndex ID = 651
+ sqALIndex ID = 652
+ sqMKIndex ID = 653
+ sqXKIndex ID = 654
+ srIndex ID = 655
+ srCyrlIndex ID = 656
+ srCyrlBAIndex ID = 657
+ srCyrlMEIndex ID = 658
+ srCyrlRSIndex ID = 659
+ srCyrlXKIndex ID = 660
+ srLatnIndex ID = 661
+ srLatnBAIndex ID = 662
+ srLatnMEIndex ID = 663
+ srLatnRSIndex ID = 664
+ srLatnXKIndex ID = 665
+ ssIndex ID = 666
+ ssyIndex ID = 667
+ stIndex ID = 668
+ svIndex ID = 669
+ svAXIndex ID = 670
+ svFIIndex ID = 671
+ svSEIndex ID = 672
+ swIndex ID = 673
+ swCDIndex ID = 674
+ swKEIndex ID = 675
+ swTZIndex ID = 676
+ swUGIndex ID = 677
+ syrIndex ID = 678
+ taIndex ID = 679
+ taINIndex ID = 680
+ taLKIndex ID = 681
+ taMYIndex ID = 682
+ taSGIndex ID = 683
+ teIndex ID = 684
+ teINIndex ID = 685
+ teoIndex ID = 686
+ teoKEIndex ID = 687
+ teoUGIndex ID = 688
+ tgIndex ID = 689
+ tgTJIndex ID = 690
+ thIndex ID = 691
+ thTHIndex ID = 692
+ tiIndex ID = 693
+ tiERIndex ID = 694
+ tiETIndex ID = 695
+ tigIndex ID = 696
+ tkIndex ID = 697
+ tkTMIndex ID = 698
+ tlIndex ID = 699
+ tnIndex ID = 700
+ toIndex ID = 701
+ toTOIndex ID = 702
+ trIndex ID = 703
+ trCYIndex ID = 704
+ trTRIndex ID = 705
+ tsIndex ID = 706
+ ttIndex ID = 707
+ ttRUIndex ID = 708
+ twqIndex ID = 709
+ twqNEIndex ID = 710
+ tzmIndex ID = 711
+ tzmMAIndex ID = 712
+ ugIndex ID = 713
+ ugCNIndex ID = 714
+ ukIndex ID = 715
+ ukUAIndex ID = 716
+ urIndex ID = 717
+ urINIndex ID = 718
+ urPKIndex ID = 719
+ uzIndex ID = 720
+ uzArabIndex ID = 721
+ uzArabAFIndex ID = 722
+ uzCyrlIndex ID = 723
+ uzCyrlUZIndex ID = 724
+ uzLatnIndex ID = 725
+ uzLatnUZIndex ID = 726
+ vaiIndex ID = 727
+ vaiLatnIndex ID = 728
+ vaiLatnLRIndex ID = 729
+ vaiVaiiIndex ID = 730
+ vaiVaiiLRIndex ID = 731
+ veIndex ID = 732
+ viIndex ID = 733
+ viVNIndex ID = 734
+ voIndex ID = 735
+ vo001Index ID = 736
+ vunIndex ID = 737
+ vunTZIndex ID = 738
+ waIndex ID = 739
+ waeIndex ID = 740
+ waeCHIndex ID = 741
+ woIndex ID = 742
+ woSNIndex ID = 743
+ xhIndex ID = 744
+ xogIndex ID = 745
+ xogUGIndex ID = 746
+ yavIndex ID = 747
+ yavCMIndex ID = 748
+ yiIndex ID = 749
+ yi001Index ID = 750
+ yoIndex ID = 751
+ yoBJIndex ID = 752
+ yoNGIndex ID = 753
+ yueIndex ID = 754
+ yueHansIndex ID = 755
+ yueHansCNIndex ID = 756
+ yueHantIndex ID = 757
+ yueHantHKIndex ID = 758
+ zghIndex ID = 759
+ zghMAIndex ID = 760
+ zhIndex ID = 761
+ zhHansIndex ID = 762
+ zhHansCNIndex ID = 763
+ zhHansHKIndex ID = 764
+ zhHansMOIndex ID = 765
+ zhHansSGIndex ID = 766
+ zhHantIndex ID = 767
+ zhHantHKIndex ID = 768
+ zhHantMOIndex ID = 769
+ zhHantTWIndex ID = 770
+ zuIndex ID = 771
+ zuZAIndex ID = 772
+ caESvalenciaIndex ID = 773
+ enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+ // Entry 0 - 1F
+ 0x00000000, 0x01600000, 0x016000d2, 0x01600161,
+ 0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
+ 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
+ 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
+ 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
+ 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
+ 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
+ 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+ // Entry 20 - 3F
+ 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
+ 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
+ 0x04300000, 0x04300099, 0x04400000, 0x0440012f,
+ 0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
+ 0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
+ 0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+ 0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
+ 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+ // Entry 40 - 5F
+ 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
+ 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
+ 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
+ 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
+ 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
+ 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
+ 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
+ 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+ // Entry 60 - 7F
+ 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
+ 0x10000000, 0x1000007b, 0x10100000, 0x10100063,
+ 0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
+ 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
+ 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
+ 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
+ 0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
+ 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+ // Entry 80 - 9F
+ 0x13000000, 0x13000080, 0x13000122, 0x13600000,
+ 0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+ 0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+ 0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+ 0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+ 0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+ 0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
+ 0x13900060, 0x13900061, 0x13900063, 0x13900064,
+ // Entry A0 - BF
+ 0x1390006d, 0x13900072, 0x13900073, 0x13900074,
+ 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
+ 0x13900080, 0x13900081, 0x13900083, 0x1390008a,
+ 0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
+ 0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
+ 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
+ 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
+ 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+ // Entry C0 - DF
+ 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
+ 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
+ 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
+ 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
+ 0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
+ 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
+ 0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
+ 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+ // Entry E0 - FF
+ 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
+ 0x13900131, 0x13900133, 0x13900135, 0x13900139,
+ 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
+ 0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+ 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+ 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+ 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
+ 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+ // Entry 100 - 11F
+ 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
+ 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
+ 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
+ 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
+ 0x14500000, 0x1450006e, 0x14600000, 0x14600052,
+ 0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
+ 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
+ 0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+ // Entry 120 - 13F
+ 0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+ 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+ 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+ 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+ 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
+ 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
+ 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
+ 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+ // Entry 140 - 15F
+ 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
+ 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
+ 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
+ 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
+ 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
+ 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
+ 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
+ 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+ // Entry 160 - 17F
+ 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
+ 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
+ 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
+ 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
+ 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
+ 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
+ 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
+ 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+ // Entry 180 - 19F
+ 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
+ 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
+ 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
+ 0x200000a2, 0x20300000, 0x20700000, 0x20700052,
+ 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
+ 0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
+ 0x21200067, 0x21600000, 0x21700000, 0x217000a4,
+ 0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+ // Entry 1A0 - 1BF
+ 0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
+ 0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
+ 0x24400052, 0x24500000, 0x24500082, 0x24600000,
+ 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
+ 0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
+ 0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
+ 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
+ 0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+ // Entry 1C0 - 1DF
+ 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
+ 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
+ 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+ 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+ 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
+ 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
+ 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
+ 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+ // Entry 1E0 - 1FF
+ 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
+ 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
+ 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
+ 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
+ 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
+ 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
+ 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
+ 0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+ // Entry 200 - 21F
+ 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
+ 0x34700000, 0x347000da, 0x34700110, 0x34e00000,
+ 0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
+ 0x35100000, 0x35100099, 0x351000db, 0x36700000,
+ 0x36700030, 0x36700036, 0x36700040, 0x3670005b,
+ 0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
+ 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+ 0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+ // Entry 220 - 23F
+ 0x37a00000, 0x38000000, 0x38000117, 0x38700000,
+ 0x38900000, 0x38900131, 0x39000000, 0x3900006f,
+ 0x390000a4, 0x39500000, 0x39500099, 0x39800000,
+ 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
+ 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
+ 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+ 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+ 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+ // Entry 240 - 25F
+ 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
+ 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
+ 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+ 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+ 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
+ 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
+ 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
+ 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+ // Entry 260 - 27F
+ 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
+ 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
+ 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
+ 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+ 0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+ 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
+ 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
+ 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+ // Entry 280 - 29F
+ 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
+ 0x42300000, 0x42300164, 0x42900000, 0x42900062,
+ 0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
+ 0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
+ 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
+ 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
+ 0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
+ 0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+ // Entry 2A0 - 2BF
+ 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
+ 0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
+ 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
+ 0x46100000, 0x46100099, 0x46400000, 0x464000a4,
+ 0x46400131, 0x46700000, 0x46700124, 0x46b00000,
+ 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
+ 0x47100000, 0x47600000, 0x47600127, 0x47a00000,
+ 0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+ // Entry 2C0 - 2DF
+ 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
+ 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
+ 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+ 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+ 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
+ 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
+ 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
+ 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+ // Entry 2E0 - 2FF
+ 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
+ 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
+ 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+ 0x50900052, 0x51200000, 0x51200001, 0x51800000,
+ 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
+ 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
+ 0x528000ba, 0x52900000, 0x52938000, 0x52938053,
+ 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
+ // Entry 300 - 31F
+ 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
+ 0x52f00161,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compact/tags.go b/src/dma/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 00000000..ca135d29
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag{language: afIndex, locale: afIndex}
+ Amharic Tag = Tag{language: amIndex, locale: amIndex}
+ Arabic Tag = Tag{language: arIndex, locale: arIndex}
+ ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+ Azerbaijani Tag = Tag{language: azIndex, locale: azIndex}
+ Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex}
+ Bengali Tag = Tag{language: bnIndex, locale: bnIndex}
+ Catalan Tag = Tag{language: caIndex, locale: caIndex}
+ Czech Tag = Tag{language: csIndex, locale: csIndex}
+ Danish Tag = Tag{language: daIndex, locale: daIndex}
+ German Tag = Tag{language: deIndex, locale: deIndex}
+ Greek Tag = Tag{language: elIndex, locale: elIndex}
+ English Tag = Tag{language: enIndex, locale: enIndex}
+ AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex}
+ BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex}
+ Spanish Tag = Tag{language: esIndex, locale: esIndex}
+ EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex}
+ LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+ Estonian Tag = Tag{language: etIndex, locale: etIndex}
+ Persian Tag = Tag{language: faIndex, locale: faIndex}
+ Finnish Tag = Tag{language: fiIndex, locale: fiIndex}
+ Filipino Tag = Tag{language: filIndex, locale: filIndex}
+ French Tag = Tag{language: frIndex, locale: frIndex}
+ CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex}
+ Gujarati Tag = Tag{language: guIndex, locale: guIndex}
+ Hebrew Tag = Tag{language: heIndex, locale: heIndex}
+ Hindi Tag = Tag{language: hiIndex, locale: hiIndex}
+ Croatian Tag = Tag{language: hrIndex, locale: hrIndex}
+ Hungarian Tag = Tag{language: huIndex, locale: huIndex}
+ Armenian Tag = Tag{language: hyIndex, locale: hyIndex}
+ Indonesian Tag = Tag{language: idIndex, locale: idIndex}
+ Icelandic Tag = Tag{language: isIndex, locale: isIndex}
+ Italian Tag = Tag{language: itIndex, locale: itIndex}
+ Japanese Tag = Tag{language: jaIndex, locale: jaIndex}
+ Georgian Tag = Tag{language: kaIndex, locale: kaIndex}
+ Kazakh Tag = Tag{language: kkIndex, locale: kkIndex}
+ Khmer Tag = Tag{language: kmIndex, locale: kmIndex}
+ Kannada Tag = Tag{language: knIndex, locale: knIndex}
+ Korean Tag = Tag{language: koIndex, locale: koIndex}
+ Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex}
+ Lao Tag = Tag{language: loIndex, locale: loIndex}
+ Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex}
+ Latvian Tag = Tag{language: lvIndex, locale: lvIndex}
+ Macedonian Tag = Tag{language: mkIndex, locale: mkIndex}
+ Malayalam Tag = Tag{language: mlIndex, locale: mlIndex}
+ Mongolian Tag = Tag{language: mnIndex, locale: mnIndex}
+ Marathi Tag = Tag{language: mrIndex, locale: mrIndex}
+ Malay Tag = Tag{language: msIndex, locale: msIndex}
+ Burmese Tag = Tag{language: myIndex, locale: myIndex}
+ Nepali Tag = Tag{language: neIndex, locale: neIndex}
+ Dutch Tag = Tag{language: nlIndex, locale: nlIndex}
+ Norwegian Tag = Tag{language: noIndex, locale: noIndex}
+ Punjabi Tag = Tag{language: paIndex, locale: paIndex}
+ Polish Tag = Tag{language: plIndex, locale: plIndex}
+ Portuguese Tag = Tag{language: ptIndex, locale: ptIndex}
+ BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+ EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+ Romanian Tag = Tag{language: roIndex, locale: roIndex}
+ Russian Tag = Tag{language: ruIndex, locale: ruIndex}
+ Sinhala Tag = Tag{language: siIndex, locale: siIndex}
+ Slovak Tag = Tag{language: skIndex, locale: skIndex}
+ Slovenian Tag = Tag{language: slIndex, locale: slIndex}
+ Albanian Tag = Tag{language: sqIndex, locale: sqIndex}
+ Serbian Tag = Tag{language: srIndex, locale: srIndex}
+ SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+ Swedish Tag = Tag{language: svIndex, locale: svIndex}
+ Swahili Tag = Tag{language: swIndex, locale: swIndex}
+ Tamil Tag = Tag{language: taIndex, locale: taIndex}
+ Telugu Tag = Tag{language: teIndex, locale: teIndex}
+ Thai Tag = Tag{language: thIndex, locale: thIndex}
+ Turkish Tag = Tag{language: trIndex, locale: trIndex}
+ Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex}
+ Urdu Tag = Tag{language: urIndex, locale: urIndex}
+ Uzbek Tag = Tag{language: uzIndex, locale: uzIndex}
+ Vietnamese Tag = Tag{language: viIndex, locale: viIndex}
+ Chinese Tag = Tag{language: zhIndex, locale: zhIndex}
+ SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+ TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+ Zulu Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/compose.go b/src/dma/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 00000000..4ae78e0f
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "sort"
+ "strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+ Tag Tag
+
+ private string // the x extension
+ variants []string
+ extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+ t := b.Tag
+
+ if len(b.extensions) > 0 || len(b.variants) > 0 {
+ sort.Sort(sortVariants(b.variants))
+ sort.Strings(b.extensions)
+
+ if b.private != "" {
+ b.extensions = append(b.extensions, b.private)
+ }
+ n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+ buf := make([]byte, n)
+ p := t.genCoreBytes(buf)
+ t.pVariant = byte(p)
+ p += appendTokens(buf[p:], b.variants...)
+ t.pExt = uint16(p)
+ p += appendTokens(buf[p:], b.extensions...)
+ t.str = string(buf[:p])
+ // We may not always need to remake the string, but when or when not
+ // to do so is rather tricky.
+ scan := makeScanner(buf[:p])
+ t, _ = parse(&scan, "")
+ return t
+
+ } else if b.private != "" {
+ t.str = b.private
+ t.RemakeString()
+ }
+ return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+ b.Tag.LangID = t.LangID
+ b.Tag.RegionID = t.RegionID
+ b.Tag.ScriptID = t.ScriptID
+ // TODO: optimize
+ b.variants = b.variants[:0]
+ if variants := t.Variants(); variants != "" {
+ for _, vr := range strings.Split(variants[1:], "-") {
+ b.variants = append(b.variants, vr)
+ }
+ }
+ b.extensions, b.private = b.extensions[:0], ""
+ for _, e := range t.Extensions() {
+ b.AddExt(e)
+ }
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+ if e[0] == 'x' {
+ if b.private == "" {
+ b.private = e
+ }
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] += e[1:]
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+ if e[0] == 'x' {
+ b.private = e
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] = e + s[1:]
+ } else {
+ b.extensions[i] = e
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+ for _, v := range v {
+ if v != "" {
+ b.variants = append(b.variants, v)
+ }
+ }
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+ b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+ b.private = ""
+ b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+ for _, t := range token {
+ n += len(t) + 1
+ }
+ return
+}
+
+func appendTokens(b []byte, token ...string) int {
+ p := 0
+ for _, t := range token {
+ b[p] = '-'
+ copy(b[p+1:], t)
+ p += 1 + len(t)
+ }
+ return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+ return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+ s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+ return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/coverage.go b/src/dma/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 00000000..9b20b88f
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+ base := make([]Language, 0, NumLanguages)
+ for i := 0; i < langNoIndexOffset; i++ {
+ // We included "und" already for the value 0.
+ if i != nonCanonicalUnd {
+ base = append(base, Language(i))
+ }
+ }
+ i := langNoIndexOffset
+ for _, v := range langNoIndex {
+ for k := 0; k < 8; k++ {
+ if v&1 == 1 {
+ base = append(base, Language(i))
+ }
+ v >>= 1
+ i++
+ }
+ }
+ return base
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/gen.go b/src/dma/vendor/golang.org/x/text/internal/language/gen.go
new file mode 100644
index 00000000..cdcc7feb
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/gen.go
@@ -0,0 +1,1520 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+ "bufio"
+ "flag"
+ "fmt"
+ "io"
+ "io/ioutil"
+ "log"
+ "math"
+ "reflect"
+ "regexp"
+ "sort"
+ "strconv"
+ "strings"
+
+ "golang.org/x/text/internal/gen"
+ "golang.org/x/text/internal/tag"
+ "golang.org/x/text/unicode/cldr"
+)
+
+var (
+ test = flag.Bool("test",
+ false,
+ "test existing tables; can be used to compare web data with package data.")
+ outputFile = flag.String("output",
+ "tables.go",
+ "output file for generated tables")
+)
+
+var comment = []string{
+ `
+lang holds an alphabetically sorted list of ISO-639 language identifiers.
+All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+For 2-byte language identifiers, the two successive bytes have the following meaning:
+ - if the first letter of the 2- and 3-letter ISO codes are the same:
+ the second and third letter of the 3-letter ISO code.
+ - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+For 3-byte language identifiers the 4th byte is 0.`,
+ `
+langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+in lookup tables. The language ids for these language codes are derived directly
+from the letters and are not consecutive.`,
+ `
+altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+to 2-letter language codes that cannot be derived using the method described above.
+Each 3-letter code is followed by its 1-byte langID.`,
+ `
+altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
+ `
+AliasMap maps langIDs to their suggested replacements.`,
+ `
+script is an alphabetically sorted list of ISO 15924 codes. The index
+of the script in the string, divided by 4, is the internal scriptID.`,
+ `
+isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+the UN.M49 codes used for groups.)`,
+ `
+regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+Each 2-letter codes is followed by two bytes with the following meaning:
+ - [A-Z}{2}: the first letter of the 2-letter code plus these two
+ letters form the 3-letter ISO code.
+ - 0, n: index into altRegionISO3.`,
+ `
+regionTypes defines the status of a region for various standards.`,
+ `
+m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+codes indicating collections of regions.`,
+ `
+m49Index gives indexes into fromM49 based on the three most significant bits
+of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+ fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+The region code is stored in the 9 lsb of the indexed value.`,
+ `
+fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
+ `
+altRegionISO3 holds a list of 3-letter region codes that cannot be
+mapped to 2-letter codes using the default algorithm. This is a short list.`,
+ `
+altRegionIDs holds a list of regionIDs the positions of which match those
+of the 3-letter ISO codes in altRegionISO3.`,
+ `
+variantNumSpecialized is the number of specialized variants in variants.`,
+ `
+suppressScript is an index from langID to the dominant script for that language,
+if it exists. If a script is given, it should be suppressed from the language tag.`,
+ `
+likelyLang is a lookup table, indexed by langID, for the most likely
+scripts and regions given incomplete information. If more entries exist for a
+given language, region and script are the index and size respectively
+of the list in likelyLangList.`,
+ `
+likelyLangList holds lists info associated with likelyLang.`,
+ `
+likelyRegion is a lookup table, indexed by regionID, for the most likely
+languages and scripts given incomplete information. If more entries exist
+for a given regionID, lang and script are the index and size respectively
+of the list in likelyRegionList.
+TODO: exclude containers and user-definable regions from the list.`,
+ `
+likelyRegionList holds lists info associated with likelyRegion.`,
+ `
+likelyScript is a lookup table, indexed by scriptID, for the most likely
+languages and regions given a script.`,
+ `
+nRegionGroups is the number of region groups.`,
+ `
+regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+where each set holds all groupings that are directly connected in a region
+containment graph.`,
+ `
+regionInclusionBits is an array of bit vectors where every vector represents
+a set of region groupings. These sets are used to compute the distance
+between two regions for the purpose of language matching.`,
+ `
+regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+all groups that are reachable from the groups set in the respective entry.`,
+}
+
+// TODO: consider changing some of these structures to tries. This can reduce
+// memory, but may increase the need for memory allocations. This could be
+// mitigated if we can piggyback on language tags for common cases.
+
+func failOnError(e error) {
+ if e != nil {
+ log.Panic(e)
+ }
+}
+
+type setType int
+
+const (
+ Indexed setType = 1 + iota // all elements must be of same size
+ Linear
+)
+
+type stringSet struct {
+ s []string
+ sorted, frozen bool
+
+ // We often need to update values after the creation of an index is completed.
+ // We include a convenience map for keeping track of this.
+ update map[string]string
+ typ setType // used for checking.
+}
+
+func (ss *stringSet) clone() stringSet {
+ c := *ss
+ c.s = append([]string(nil), c.s...)
+ return c
+}
+
+func (ss *stringSet) setType(t setType) {
+ if ss.typ != t && ss.typ != 0 {
+ log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
+ }
+}
+
+// parse parses a whitespace-separated string and initializes ss with its
+// components.
+func (ss *stringSet) parse(s string) {
+ scan := bufio.NewScanner(strings.NewReader(s))
+ scan.Split(bufio.ScanWords)
+ for scan.Scan() {
+ ss.add(scan.Text())
+ }
+}
+
+func (ss *stringSet) assertChangeable() {
+ if ss.frozen {
+ log.Panic("attempt to modify a frozen stringSet")
+ }
+}
+
+func (ss *stringSet) add(s string) {
+ ss.assertChangeable()
+ ss.s = append(ss.s, s)
+ ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) freeze() {
+ ss.compact()
+ ss.frozen = true
+}
+
+func (ss *stringSet) compact() {
+ if ss.sorted {
+ return
+ }
+ a := ss.s
+ sort.Strings(a)
+ k := 0
+ for i := 1; i < len(a); i++ {
+ if a[k] != a[i] {
+ a[k+1] = a[i]
+ k++
+ }
+ }
+ ss.s = a[:k+1]
+ ss.sorted = ss.frozen
+}
+
+type funcSorter struct {
+ fn func(a, b string) bool
+ sort.StringSlice
+}
+
+func (s funcSorter) Less(i, j int) bool {
+ return s.fn(s.StringSlice[i], s.StringSlice[j])
+}
+
+func (ss *stringSet) sortFunc(f func(a, b string) bool) {
+ ss.compact()
+ sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
+}
+
+func (ss *stringSet) remove(s string) {
+ ss.assertChangeable()
+ if i, ok := ss.find(s); ok {
+ copy(ss.s[i:], ss.s[i+1:])
+ ss.s = ss.s[:len(ss.s)-1]
+ }
+}
+
+func (ss *stringSet) replace(ol, nu string) {
+ ss.s[ss.index(ol)] = nu
+ ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) index(s string) int {
+ ss.setType(Indexed)
+ i, ok := ss.find(s)
+ if !ok {
+ if i < len(ss.s) {
+ log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
+ }
+ log.Panicf("find: item %q is not in list", s)
+
+ }
+ return i
+}
+
+func (ss *stringSet) find(s string) (int, bool) {
+ ss.compact()
+ i := sort.SearchStrings(ss.s, s)
+ return i, i != len(ss.s) && ss.s[i] == s
+}
+
+func (ss *stringSet) slice() []string {
+ ss.compact()
+ return ss.s
+}
+
+func (ss *stringSet) updateLater(v, key string) {
+ if ss.update == nil {
+ ss.update = map[string]string{}
+ }
+ ss.update[v] = key
+}
+
+// join joins the string and ensures that all entries are of the same length.
+func (ss *stringSet) join() string {
+ ss.setType(Indexed)
+ n := len(ss.s[0])
+ for _, s := range ss.s {
+ if len(s) != n {
+ log.Panicf("join: not all entries are of the same length: %q", s)
+ }
+ }
+ ss.s = append(ss.s, strings.Repeat("\xff", n))
+ return strings.Join(ss.s, "")
+}
+
+// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
+// All types use the same entry.
+// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
+// fields.
+type ianaEntry struct {
+ typ string
+ description []string
+ scope string
+ added string
+ preferred string
+ deprecated string
+ suppressScript string
+ macro string
+ prefix []string
+}
+
+type builder struct {
+ w *gen.CodeWriter
+ hw io.Writer // MultiWriter for w and w.Hash
+ data *cldr.CLDR
+ supp *cldr.SupplementalData
+
+ // indices
+ locale stringSet // common locales
+ lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data
+ langNoIndex stringSet // 3-letter ISO codes with no associated data
+ script stringSet // 4-letter ISO codes
+ region stringSet // 2-letter ISO or 3-digit UN M49 codes
+ variant stringSet // 4-8-alphanumeric variant code.
+
+ // Region codes that are groups with their corresponding group IDs.
+ groups map[int]index
+
+ // langInfo
+ registry map[string]*ianaEntry
+}
+
+type index uint
+
+func newBuilder(w *gen.CodeWriter) *builder {
+ r := gen.OpenCLDRCoreZip()
+ defer r.Close()
+ d := &cldr.Decoder{}
+ data, err := d.DecodeZip(r)
+ failOnError(err)
+ b := builder{
+ w: w,
+ hw: io.MultiWriter(w, w.Hash),
+ data: data,
+ supp: data.Supplemental(),
+ }
+ b.parseRegistry()
+ return &b
+}
+
+func (b *builder) parseRegistry() {
+ r := gen.OpenIANAFile("assignments/language-subtag-registry")
+ defer r.Close()
+ b.registry = make(map[string]*ianaEntry)
+
+ scan := bufio.NewScanner(r)
+ scan.Split(bufio.ScanWords)
+ var record *ianaEntry
+ for more := scan.Scan(); more; {
+ key := scan.Text()
+ more = scan.Scan()
+ value := scan.Text()
+ switch key {
+ case "Type:":
+ record = &ianaEntry{typ: value}
+ case "Subtag:", "Tag:":
+ if s := strings.SplitN(value, "..", 2); len(s) > 1 {
+ for a := s[0]; a <= s[1]; a = inc(a) {
+ b.addToRegistry(a, record)
+ }
+ } else {
+ b.addToRegistry(value, record)
+ }
+ case "Suppress-Script:":
+ record.suppressScript = value
+ case "Added:":
+ record.added = value
+ case "Deprecated:":
+ record.deprecated = value
+ case "Macrolanguage:":
+ record.macro = value
+ case "Preferred-Value:":
+ record.preferred = value
+ case "Prefix:":
+ record.prefix = append(record.prefix, value)
+ case "Scope:":
+ record.scope = value
+ case "Description:":
+ buf := []byte(value)
+ for more = scan.Scan(); more; more = scan.Scan() {
+ b := scan.Bytes()
+ if b[0] == '%' || b[len(b)-1] == ':' {
+ break
+ }
+ buf = append(buf, ' ')
+ buf = append(buf, b...)
+ }
+ record.description = append(record.description, string(buf))
+ continue
+ default:
+ continue
+ }
+ more = scan.Scan()
+ }
+ if scan.Err() != nil {
+ log.Panic(scan.Err())
+ }
+}
+
+func (b *builder) addToRegistry(key string, entry *ianaEntry) {
+ if info, ok := b.registry[key]; ok {
+ if info.typ != "language" || entry.typ != "extlang" {
+ log.Fatalf("parseRegistry: tag %q already exists", key)
+ }
+ } else {
+ b.registry[key] = entry
+ }
+}
+
+var commentIndex = make(map[string]string)
+
+func init() {
+ for _, s := range comment {
+ key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
+ commentIndex[key] = s
+ }
+}
+
+func (b *builder) comment(name string) {
+ if s := commentIndex[name]; len(s) > 0 {
+ b.w.WriteComment(s)
+ } else {
+ fmt.Fprintln(b.w)
+ }
+}
+
+func (b *builder) pf(f string, x ...interface{}) {
+ fmt.Fprintf(b.hw, f, x...)
+ fmt.Fprint(b.hw, "\n")
+}
+
+func (b *builder) p(x ...interface{}) {
+ fmt.Fprintln(b.hw, x...)
+}
+
+func (b *builder) addSize(s int) {
+ b.w.Size += s
+ b.pf("// Size: %d bytes", s)
+}
+
+func (b *builder) writeConst(name string, x interface{}) {
+ b.comment(name)
+ b.w.WriteConst(name, x)
+}
+
+// writeConsts computes f(v) for all v in values and writes the results
+// as constants named _v to a single constant block.
+func (b *builder) writeConsts(f func(string) int, values ...string) {
+ b.pf("const (")
+ for _, v := range values {
+ b.pf("\t_%s = %v", v, f(v))
+ }
+ b.pf(")")
+}
+
+// writeType writes the type of the given value, which must be a struct.
+func (b *builder) writeType(value interface{}) {
+ b.comment(reflect.TypeOf(value).Name())
+ b.w.WriteType(value)
+}
+
+func (b *builder) writeSlice(name string, ss interface{}) {
+ b.writeSliceAddSize(name, 0, ss)
+}
+
+func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
+ b.comment(name)
+ b.w.Size += extraSize
+ v := reflect.ValueOf(ss)
+ t := v.Type().Elem()
+ b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
+
+ fmt.Fprintf(b.w, "var %s = ", name)
+ b.w.WriteArray(ss)
+ b.p()
+}
+
+type FromTo struct {
+ From, To uint16
+}
+
+func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
+ ss.sortFunc(func(a, b string) bool {
+ return index(a) < index(b)
+ })
+ m := []FromTo{}
+ for _, s := range ss.s {
+ m = append(m, FromTo{index(s), index(ss.update[s])})
+ }
+ b.writeSlice(name, m)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s string) uint {
+ v := uint(0)
+ for i := 0; i < len(s); i++ {
+ v *= base
+ v += uint(s[i] - 'a')
+ }
+ return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+ for i := len(s) - 1; i >= 0; i-- {
+ s[i] = byte(v%base) + 'a'
+ v /= base
+ }
+}
+
+func (b *builder) writeBitVector(name string, ss []string) {
+ vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
+ for _, s := range ss {
+ v := strToInt(s)
+ vec[v/8] |= 1 << (v % 8)
+ }
+ b.writeSlice(name, vec)
+}
+
+// TODO: convert this type into a list or two-stage trie.
+func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
+ b.comment(name)
+ v := reflect.ValueOf(m)
+ sz := v.Len() * (2 + int(v.Type().Key().Size()))
+ for _, k := range m {
+ sz += len(k)
+ }
+ b.addSize(sz)
+ keys := []string{}
+ b.pf(`var %s = map[string]uint16{`, name)
+ for k := range m {
+ keys = append(keys, k)
+ }
+ sort.Strings(keys)
+ for _, k := range keys {
+ b.pf("\t%q: %v,", k, f(m[k]))
+ }
+ b.p("}")
+}
+
+func (b *builder) writeMap(name string, m interface{}) {
+ b.comment(name)
+ v := reflect.ValueOf(m)
+ sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
+ b.addSize(sz)
+ f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
+ return strings.IndexRune("{}, ", r) != -1
+ })
+ sort.Strings(f[1:])
+ b.pf(`var %s = %s{`, name, f[0])
+ for _, kv := range f[1:] {
+ b.pf("\t%s,", kv)
+ }
+ b.p("}")
+}
+
+func (b *builder) langIndex(s string) uint16 {
+ if s == "und" {
+ return 0
+ }
+ if i, ok := b.lang.find(s); ok {
+ return uint16(i)
+ }
+ return uint16(strToInt(s)) + uint16(len(b.lang.s))
+}
+
+// inc advances the string to its lexicographical successor.
+func inc(s string) string {
+ const maxTagLength = 4
+ var buf [maxTagLength]byte
+ intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
+ for i := 0; i < len(s); i++ {
+ if s[i] <= 'Z' {
+ buf[i] -= 'a' - 'A'
+ }
+ }
+ return string(buf[:len(s)])
+}
+
+func (b *builder) parseIndices() {
+ meta := b.supp.Metadata
+
+ for k, v := range b.registry {
+ var ss *stringSet
+ switch v.typ {
+ case "language":
+ if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
+ b.lang.add(k)
+ continue
+ } else {
+ ss = &b.langNoIndex
+ }
+ case "region":
+ ss = &b.region
+ case "script":
+ ss = &b.script
+ case "variant":
+ ss = &b.variant
+ default:
+ continue
+ }
+ ss.add(k)
+ }
+ // Include any language for which there is data.
+ for _, lang := range b.data.Locales() {
+ if x := b.data.RawLDML(lang); false ||
+ x.LocaleDisplayNames != nil ||
+ x.Characters != nil ||
+ x.Delimiters != nil ||
+ x.Measurement != nil ||
+ x.Dates != nil ||
+ x.Numbers != nil ||
+ x.Units != nil ||
+ x.ListPatterns != nil ||
+ x.Collations != nil ||
+ x.Segmentations != nil ||
+ x.Rbnf != nil ||
+ x.Annotations != nil ||
+ x.Metadata != nil {
+
+ from := strings.Split(lang, "_")
+ if lang := from[0]; lang != "root" {
+ b.lang.add(lang)
+ }
+ }
+ }
+ // Include locales for plural rules, which uses a different structure.
+ for _, plurals := range b.data.Supplemental().Plurals {
+ for _, rules := range plurals.PluralRules {
+ for _, lang := range strings.Split(rules.Locales, " ") {
+ if lang = strings.Split(lang, "_")[0]; lang != "root" {
+ b.lang.add(lang)
+ }
+ }
+ }
+ }
+ // Include languages in likely subtags.
+ for _, m := range b.supp.LikelySubtags.LikelySubtag {
+ from := strings.Split(m.From, "_")
+ b.lang.add(from[0])
+ }
+ // Include ISO-639 alpha-3 bibliographic entries.
+ for _, a := range meta.Alias.LanguageAlias {
+ if a.Reason == "bibliographic" {
+ b.langNoIndex.add(a.Type)
+ }
+ }
+ // Include regions in territoryAlias (not all are in the IANA registry!)
+ for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+ if len(reg.Type) == 2 {
+ b.region.add(reg.Type)
+ }
+ }
+
+ for _, s := range b.lang.s {
+ if len(s) == 3 {
+ b.langNoIndex.remove(s)
+ }
+ }
+ b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
+ b.writeConst("NumScripts", len(b.script.slice()))
+ b.writeConst("NumRegions", len(b.region.slice()))
+
+ // Add dummy codes at the start of each list to represent "unspecified".
+ b.lang.add("---")
+ b.script.add("----")
+ b.region.add("---")
+
+ // common locales
+ b.locale.parse(meta.DefaultContent.Locales)
+}
+
+// TODO: region inclusion data will probably not be use used in future matchers.
+
+func (b *builder) computeRegionGroups() {
+ b.groups = make(map[int]index)
+
+ // Create group indices.
+ for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
+ b.groups[i] = index(len(b.groups))
+ }
+ for _, g := range b.supp.TerritoryContainment.Group {
+ // Skip UN and EURO zone as they are flattening the containment
+ // relationship.
+ if g.Type == "EZ" || g.Type == "UN" {
+ continue
+ }
+ group := b.region.index(g.Type)
+ if _, ok := b.groups[group]; !ok {
+ b.groups[group] = index(len(b.groups))
+ }
+ }
+ if len(b.groups) > 64 {
+ log.Fatalf("only 64 groups supported, found %d", len(b.groups))
+ }
+ b.writeConst("nRegionGroups", len(b.groups))
+}
+
+var langConsts = []string{
+ "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
+ "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
+ "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
+ "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
+ "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
+ "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
+
+ // constants for grandfathered tags (if not already defined)
+ "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
+ "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
+}
+
+// writeLanguage generates all tables needed for language canonicalization.
+func (b *builder) writeLanguage() {
+ meta := b.supp.Metadata
+
+ b.writeConst("nonCanonicalUnd", b.lang.index("und"))
+ b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+ b.writeConst("langPrivateStart", b.langIndex("qaa"))
+ b.writeConst("langPrivateEnd", b.langIndex("qtz"))
+
+ // Get language codes that need to be mapped (overlong 3-letter codes,
+ // deprecated 2-letter codes, legacy and grandfathered tags.)
+ langAliasMap := stringSet{}
+ aliasTypeMap := map[string]AliasType{}
+
+ // altLangISO3 get the alternative ISO3 names that need to be mapped.
+ altLangISO3 := stringSet{}
+ // Add dummy start to avoid the use of index 0.
+ altLangISO3.add("---")
+ altLangISO3.updateLater("---", "aa")
+
+ lang := b.lang.clone()
+ for _, a := range meta.Alias.LanguageAlias {
+ if a.Replacement == "" {
+ a.Replacement = "und"
+ }
+ // TODO: support mapping to tags
+ repl := strings.SplitN(a.Replacement, "_", 2)[0]
+ if a.Reason == "overlong" {
+ if len(a.Replacement) == 2 && len(a.Type) == 3 {
+ lang.updateLater(a.Replacement, a.Type)
+ }
+ } else if len(a.Type) <= 3 {
+ switch a.Reason {
+ case "macrolanguage":
+ aliasTypeMap[a.Type] = Macro
+ case "deprecated":
+ // handled elsewhere
+ continue
+ case "bibliographic", "legacy":
+ if a.Type == "no" {
+ continue
+ }
+ aliasTypeMap[a.Type] = Legacy
+ default:
+ log.Fatalf("new %s alias: %s", a.Reason, a.Type)
+ }
+ langAliasMap.add(a.Type)
+ langAliasMap.updateLater(a.Type, repl)
+ }
+ }
+ // Manually add the mapping of "nb" (Norwegian) to its macro language.
+ // This can be removed if CLDR adopts this change.
+ langAliasMap.add("nb")
+ langAliasMap.updateLater("nb", "no")
+ aliasTypeMap["nb"] = Macro
+
+ for k, v := range b.registry {
+ // Also add deprecated values for 3-letter ISO codes, which CLDR omits.
+ if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
+ langAliasMap.add(k)
+ langAliasMap.updateLater(k, v.preferred)
+ aliasTypeMap[k] = Deprecated
+ }
+ }
+ // Fix CLDR mappings.
+ lang.updateLater("tl", "tgl")
+ lang.updateLater("sh", "hbs")
+ lang.updateLater("mo", "mol")
+ lang.updateLater("no", "nor")
+ lang.updateLater("tw", "twi")
+ lang.updateLater("nb", "nob")
+ lang.updateLater("ak", "aka")
+ lang.updateLater("bh", "bih")
+
+ // Ensure that each 2-letter code is matched with a 3-letter code.
+ for _, v := range lang.s[1:] {
+ s, ok := lang.update[v]
+ if !ok {
+ if s, ok = lang.update[langAliasMap.update[v]]; !ok {
+ continue
+ }
+ lang.update[v] = s
+ }
+ if v[0] != s[0] {
+ altLangISO3.add(s)
+ altLangISO3.updateLater(s, v)
+ }
+ }
+
+ // Complete canonicalized language tags.
+ lang.freeze()
+ for i, v := range lang.s {
+ // We can avoid these manual entries by using the IANA registry directly.
+ // Seems easier to update the list manually, as changes are rare.
+ // The panic in this loop will trigger if we miss an entry.
+ add := ""
+ if s, ok := lang.update[v]; ok {
+ if s[0] == v[0] {
+ add = s[1:]
+ } else {
+ add = string([]byte{0, byte(altLangISO3.index(s))})
+ }
+ } else if len(v) == 3 {
+ add = "\x00"
+ } else {
+ log.Panicf("no data for long form of %q", v)
+ }
+ lang.s[i] += add
+ }
+ b.writeConst("lang", tag.Index(lang.join()))
+
+ b.writeConst("langNoIndexOffset", len(b.lang.s))
+
+ // space of all valid 3-letter language identifiers.
+ b.writeBitVector("langNoIndex", b.langNoIndex.slice())
+
+ altLangIndex := []uint16{}
+ for i, s := range altLangISO3.slice() {
+ altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
+ if i > 0 {
+ idx := b.lang.index(altLangISO3.update[s])
+ altLangIndex = append(altLangIndex, uint16(idx))
+ }
+ }
+ b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
+ b.writeSlice("altLangIndex", altLangIndex)
+
+ b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex)
+ types := make([]AliasType, len(langAliasMap.s))
+ for i, s := range langAliasMap.s {
+ types[i] = aliasTypeMap[s]
+ }
+ b.writeSlice("AliasTypes", types)
+}
+
+var scriptConsts = []string{
+ "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
+ "Zzzz",
+}
+
+func (b *builder) writeScript() {
+ b.writeConsts(b.script.index, scriptConsts...)
+ b.writeConst("script", tag.Index(b.script.join()))
+
+ supp := make([]uint8, len(b.lang.slice()))
+ for i, v := range b.lang.slice()[1:] {
+ if sc := b.registry[v].suppressScript; sc != "" {
+ supp[i+1] = uint8(b.script.index(sc))
+ }
+ }
+ b.writeSlice("suppressScript", supp)
+
+ // There is only one deprecated script in CLDR. This value is hard-coded.
+ // We check here if the code must be updated.
+ for _, a := range b.supp.Metadata.Alias.ScriptAlias {
+ if a.Type != "Qaai" {
+ log.Panicf("unexpected deprecated stript %q", a.Type)
+ }
+ }
+}
+
+func parseM49(s string) int16 {
+ if len(s) == 0 {
+ return 0
+ }
+ v, err := strconv.ParseUint(s, 10, 10)
+ failOnError(err)
+ return int16(v)
+}
+
+var regionConsts = []string{
+ "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
+ "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
+}
+
+func (b *builder) writeRegion() {
+ b.writeConsts(b.region.index, regionConsts...)
+
+ isoOffset := b.region.index("AA")
+ m49map := make([]int16, len(b.region.slice()))
+ fromM49map := make(map[int16]int)
+ altRegionISO3 := ""
+ altRegionIDs := []uint16{}
+
+ b.writeConst("isoRegionOffset", isoOffset)
+
+ // 2-letter region lookup and mapping to numeric codes.
+ regionISO := b.region.clone()
+ regionISO.s = regionISO.s[isoOffset:]
+ regionISO.sorted = false
+
+ regionTypes := make([]byte, len(b.region.s))
+
+ // Is the region valid BCP 47?
+ for s, e := range b.registry {
+ if len(s) == 2 && s == strings.ToUpper(s) {
+ i := b.region.index(s)
+ for _, d := range e.description {
+ if strings.Contains(d, "Private use") {
+ regionTypes[i] = iso3166UserAssigned
+ }
+ }
+ regionTypes[i] |= bcp47Region
+ }
+ }
+
+ // Is the region a valid ccTLD?
+ r := gen.OpenIANAFile("domains/root/db")
+ defer r.Close()
+
+ buf, err := ioutil.ReadAll(r)
+ failOnError(err)
+ re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
+ for _, m := range re.FindAllSubmatch(buf, -1) {
+ i := b.region.index(strings.ToUpper(string(m[1])))
+ regionTypes[i] |= ccTLD
+ }
+
+ b.writeSlice("regionTypes", regionTypes)
+
+ iso3Set := make(map[string]int)
+ update := func(iso2, iso3 string) {
+ i := regionISO.index(iso2)
+ if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
+ regionISO.s[i] += iso3[1:]
+ iso3Set[iso3] = -1
+ } else {
+ if ok && j >= 0 {
+ regionISO.s[i] += string([]byte{0, byte(j)})
+ } else {
+ iso3Set[iso3] = len(altRegionISO3)
+ regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
+ altRegionISO3 += iso3
+ altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
+ }
+ }
+ }
+ for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+ i := regionISO.index(tc.Type) + isoOffset
+ if d := m49map[i]; d != 0 {
+ log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
+ }
+ m49 := parseM49(tc.Numeric)
+ m49map[i] = m49
+ if r := fromM49map[m49]; r == 0 {
+ fromM49map[m49] = i
+ } else if r != i {
+ dep := b.registry[regionISO.s[r-isoOffset]].deprecated
+ if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
+ fromM49map[m49] = i
+ }
+ }
+ }
+ for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
+ if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
+ from := parseM49(ta.Type)
+ if r := fromM49map[from]; r == 0 {
+ fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
+ }
+ }
+ }
+ for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+ if len(tc.Alpha3) == 3 {
+ update(tc.Type, tc.Alpha3)
+ }
+ }
+ // This entries are not included in territoryCodes. Mostly 3-letter variants
+ // of deleted codes and an entry for QU.
+ for _, m := range []struct{ iso2, iso3 string }{
+ {"CT", "CTE"},
+ {"DY", "DHY"},
+ {"HV", "HVO"},
+ {"JT", "JTN"},
+ {"MI", "MID"},
+ {"NH", "NHB"},
+ {"NQ", "ATN"},
+ {"PC", "PCI"},
+ {"PU", "PUS"},
+ {"PZ", "PCZ"},
+ {"RH", "RHO"},
+ {"VD", "VDR"},
+ {"WK", "WAK"},
+ // These three-letter codes are used for others as well.
+ {"FQ", "ATF"},
+ } {
+ update(m.iso2, m.iso3)
+ }
+ for i, s := range regionISO.s {
+ if len(s) != 4 {
+ regionISO.s[i] = s + " "
+ }
+ }
+ b.writeConst("regionISO", tag.Index(regionISO.join()))
+ b.writeConst("altRegionISO3", altRegionISO3)
+ b.writeSlice("altRegionIDs", altRegionIDs)
+
+ // Create list of deprecated regions.
+ // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
+ // Transitionally-reserved mapping not included.
+ regionOldMap := stringSet{}
+ // Include regions in territoryAlias (not all are in the IANA registry!)
+ for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+ if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
+ regionOldMap.add(reg.Type)
+ regionOldMap.updateLater(reg.Type, reg.Replacement)
+ i, _ := regionISO.find(reg.Type)
+ j, _ := regionISO.find(reg.Replacement)
+ if k := m49map[i+isoOffset]; k == 0 {
+ m49map[i+isoOffset] = m49map[j+isoOffset]
+ }
+ }
+ }
+ b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
+ return uint16(b.region.index(s))
+ })
+ // 3-digit region lookup, groupings.
+ for i := 1; i < isoOffset; i++ {
+ m := parseM49(b.region.s[i])
+ m49map[i] = m
+ fromM49map[m] = i
+ }
+ b.writeSlice("m49", m49map)
+
+ const (
+ searchBits = 7
+ regionBits = 9
+ )
+ if len(m49map) >= 1<<regionBits {
+ log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
+ }
+ m49Index := [9]int16{}
+ fromM49 := []uint16{}
+ m49 := []int{}
+ for k, _ := range fromM49map {
+ m49 = append(m49, int(k))
+ }
+ sort.Ints(m49)
+ for _, k := range m49[1:] {
+ val := (k & (1<<searchBits - 1)) << regionBits
+ fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
+ m49Index[1:][k>>searchBits] = int16(len(fromM49))
+ }
+ b.writeSlice("m49Index", m49Index)
+ b.writeSlice("fromM49", fromM49)
+}
+
+const (
+ // TODO: put these lists in regionTypes as user data? Could be used for
+ // various optimizations and refinements and could be exposed in the API.
+ iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
+ iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
+ // DY and RH are actually not deleted, but indeterminately reserved.
+ iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
+)
+
+const (
+ iso3166UserAssigned = 1 << iota
+ ccTLD
+ bcp47Region
+)
+
+func find(list []string, s string) int {
+ for i, t := range list {
+ if t == s {
+ return i
+ }
+ }
+ return -1
+}
+
+// writeVariants generates per-variant information and creates a map from variant
+// name to index value. We assign index values such that sorting multiple
+// variants by index value will result in the correct order.
+// There are two types of variants: specialized and general. Specialized variants
+// are only applicable to certain language or language-script pairs. Generalized
+// variants apply to any language. Generalized variants always sort after
+// specialized variants. We will therefore always assign a higher index value
+// to a generalized variant than any other variant. Generalized variants are
+// sorted alphabetically among themselves.
+// Specialized variants may also sort after other specialized variants. Such
+// variants will be ordered after any of the variants they may follow.
+// We assume that if a variant x is followed by a variant y, then for any prefix
+// p of x, p-x is a prefix of y. This allows us to order tags based on the
+// maximum of the length of any of its prefixes.
+// TODO: it is possible to define a set of Prefix values on variants such that
+// a total order cannot be defined to the point that this algorithm breaks.
+// In other words, we cannot guarantee the same order of variants for the
+// future using the same algorithm or for non-compliant combinations of
+// variants. For this reason, consider using simple alphabetic sorting
+// of variants and ignore Prefix restrictions altogether.
+func (b *builder) writeVariant() {
+ generalized := stringSet{}
+ specialized := stringSet{}
+ specializedExtend := stringSet{}
+ // Collate the variants by type and check assumptions.
+ for _, v := range b.variant.slice() {
+ e := b.registry[v]
+ if len(e.prefix) == 0 {
+ generalized.add(v)
+ continue
+ }
+ c := strings.Split(e.prefix[0], "-")
+ hasScriptOrRegion := false
+ if len(c) > 1 {
+ _, hasScriptOrRegion = b.script.find(c[1])
+ if !hasScriptOrRegion {
+ _, hasScriptOrRegion = b.region.find(c[1])
+
+ }
+ }
+ if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
+ // Variant is preceded by a language.
+ specialized.add(v)
+ continue
+ }
+ // Variant is preceded by another variant.
+ specializedExtend.add(v)
+ prefix := c[0] + "-"
+ if hasScriptOrRegion {
+ prefix += c[1]
+ }
+ for _, p := range e.prefix {
+ // Verify that the prefix minus the last element is a prefix of the
+ // predecessor element.
+ i := strings.LastIndex(p, "-")
+ pred := b.registry[p[i+1:]]
+ if find(pred.prefix, p[:i]) < 0 {
+ log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
+ }
+ // The sorting used below does not work in the general case. It works
+ // if we assume that variants that may be followed by others only have
+ // prefixes of the same length. Verify this.
+ count := strings.Count(p[:i], "-")
+ for _, q := range pred.prefix {
+ if c := strings.Count(q, "-"); c != count {
+ log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
+ }
+ }
+ if !strings.HasPrefix(p, prefix) {
+ log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
+ }
+ }
+ }
+
+ // Sort extended variants.
+ a := specializedExtend.s
+ less := func(v, w string) bool {
+ // Sort by the maximum number of elements.
+ maxCount := func(s string) (max int) {
+ for _, p := range b.registry[s].prefix {
+ if c := strings.Count(p, "-"); c > max {
+ max = c
+ }
+ }
+ return
+ }
+ if cv, cw := maxCount(v), maxCount(w); cv != cw {
+ return cv < cw
+ }
+ // Sort by name as tie breaker.
+ return v < w
+ }
+ sort.Sort(funcSorter{less, sort.StringSlice(a)})
+ specializedExtend.frozen = true
+
+ // Create index from variant name to index.
+ variantIndex := make(map[string]uint8)
+ add := func(s []string) {
+ for _, v := range s {
+ variantIndex[v] = uint8(len(variantIndex))
+ }
+ }
+ add(specialized.slice())
+ add(specializedExtend.s)
+ numSpecialized := len(variantIndex)
+ add(generalized.slice())
+ if n := len(variantIndex); n > 255 {
+ log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
+ }
+ b.writeMap("variantIndex", variantIndex)
+ b.writeConst("variantNumSpecialized", numSpecialized)
+}
+
+func (b *builder) writeLanguageInfo() {
+}
+
+// writeLikelyData writes tables that are used both for finding parent relations and for
+// language matching. Each entry contains additional bits to indicate the status of the
+// data to know when it cannot be used for parent relations.
+func (b *builder) writeLikelyData() {
+ const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+ )
+ type ( // generated types
+ likelyScriptRegion struct {
+ region uint16
+ script uint8
+ flags uint8
+ }
+ likelyLangScript struct {
+ lang uint16
+ script uint8
+ flags uint8
+ }
+ likelyLangRegion struct {
+ lang uint16
+ region uint16
+ }
+ // likelyTag is used for getting likely tags for group regions, where
+ // the likely region might be a region contained in the group.
+ likelyTag struct {
+ lang uint16
+ region uint16
+ script uint8
+ }
+ )
+ var ( // generated variables
+ likelyRegionGroup = make([]likelyTag, len(b.groups))
+ likelyLang = make([]likelyScriptRegion, len(b.lang.s))
+ likelyRegion = make([]likelyLangScript, len(b.region.s))
+ likelyScript = make([]likelyLangRegion, len(b.script.s))
+ likelyLangList = []likelyScriptRegion{}
+ likelyRegionList = []likelyLangScript{}
+ )
+ type fromTo struct {
+ from, to []string
+ }
+ langToOther := map[int][]fromTo{}
+ regionToOther := map[int][]fromTo{}
+ for _, m := range b.supp.LikelySubtags.LikelySubtag {
+ from := strings.Split(m.From, "_")
+ to := strings.Split(m.To, "_")
+ if len(to) != 3 {
+ log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
+ }
+ if len(from) > 3 {
+ log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
+ }
+ if from[0] != to[0] && from[0] != "und" {
+ log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
+ }
+ if len(from) == 3 {
+ if from[2] != to[2] {
+ log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
+ }
+ if from[0] != "und" {
+ log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
+ }
+ }
+ if len(from) == 1 || from[0] != "und" {
+ id := 0
+ if from[0] != "und" {
+ id = b.lang.index(from[0])
+ }
+ langToOther[id] = append(langToOther[id], fromTo{from, to})
+ } else if len(from) == 2 && len(from[1]) == 4 {
+ sid := b.script.index(from[1])
+ likelyScript[sid].lang = uint16(b.langIndex(to[0]))
+ likelyScript[sid].region = uint16(b.region.index(to[2]))
+ } else {
+ r := b.region.index(from[len(from)-1])
+ if id, ok := b.groups[r]; ok {
+ if from[0] != "und" {
+ log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
+ }
+ likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
+ likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
+ likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
+ } else {
+ regionToOther[r] = append(regionToOther[r], fromTo{from, to})
+ }
+ }
+ }
+ b.writeType(likelyLangRegion{})
+ b.writeSlice("likelyScript", likelyScript)
+
+ for id := range b.lang.s {
+ list := langToOther[id]
+ if len(list) == 1 {
+ likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
+ likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
+ } else if len(list) > 1 {
+ likelyLang[id].flags = isList
+ likelyLang[id].region = uint16(len(likelyLangList))
+ likelyLang[id].script = uint8(len(list))
+ for _, x := range list {
+ flags := uint8(0)
+ if len(x.from) > 1 {
+ if x.from[1] == x.to[2] {
+ flags = regionInFrom
+ } else {
+ flags = scriptInFrom
+ }
+ }
+ likelyLangList = append(likelyLangList, likelyScriptRegion{
+ region: uint16(b.region.index(x.to[2])),
+ script: uint8(b.script.index(x.to[1])),
+ flags: flags,
+ })
+ }
+ }
+ }
+ // TODO: merge suppressScript data with this table.
+ b.writeType(likelyScriptRegion{})
+ b.writeSlice("likelyLang", likelyLang)
+ b.writeSlice("likelyLangList", likelyLangList)
+
+ for id := range b.region.s {
+ list := regionToOther[id]
+ if len(list) == 1 {
+ likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
+ likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
+ if len(list[0].from) > 2 {
+ likelyRegion[id].flags = scriptInFrom
+ }
+ } else if len(list) > 1 {
+ likelyRegion[id].flags = isList
+ likelyRegion[id].lang = uint16(len(likelyRegionList))
+ likelyRegion[id].script = uint8(len(list))
+ for i, x := range list {
+ if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
+ log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
+ }
+ x := likelyLangScript{
+ lang: uint16(b.langIndex(x.to[0])),
+ script: uint8(b.script.index(x.to[1])),
+ }
+ if len(list[0].from) > 2 {
+ x.flags = scriptInFrom
+ }
+ likelyRegionList = append(likelyRegionList, x)
+ }
+ }
+ }
+ b.writeType(likelyLangScript{})
+ b.writeSlice("likelyRegion", likelyRegion)
+ b.writeSlice("likelyRegionList", likelyRegionList)
+
+ b.writeType(likelyTag{})
+ b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+}
+
+func (b *builder) writeRegionInclusionData() {
+ var (
+ // mm holds for each group the set of groups with a distance of 1.
+ mm = make(map[int][]index)
+
+ // containment holds for each group the transitive closure of
+ // containment of other groups.
+ containment = make(map[index][]index)
+ )
+ for _, g := range b.supp.TerritoryContainment.Group {
+ // Skip UN and EURO zone as they are flattening the containment
+ // relationship.
+ if g.Type == "EZ" || g.Type == "UN" {
+ continue
+ }
+ group := b.region.index(g.Type)
+ groupIdx := b.groups[group]
+ for _, mem := range strings.Split(g.Contains, " ") {
+ r := b.region.index(mem)
+ mm[r] = append(mm[r], groupIdx)
+ if g, ok := b.groups[r]; ok {
+ mm[group] = append(mm[group], g)
+ containment[groupIdx] = append(containment[groupIdx], g)
+ }
+ }
+ }
+
+ regionContainment := make([]uint64, len(b.groups))
+ for _, g := range b.groups {
+ l := containment[g]
+
+ // Compute the transitive closure of containment.
+ for i := 0; i < len(l); i++ {
+ l = append(l, containment[l[i]]...)
+ }
+
+ // Compute the bitmask.
+ regionContainment[g] = 1 << g
+ for _, v := range l {
+ regionContainment[g] |= 1 << v
+ }
+ }
+ b.writeSlice("regionContainment", regionContainment)
+
+ regionInclusion := make([]uint8, len(b.region.s))
+ bvs := make(map[uint64]index)
+ // Make the first bitvector positions correspond with the groups.
+ for r, i := range b.groups {
+ bv := uint64(1 << i)
+ for _, g := range mm[r] {
+ bv |= 1 << g
+ }
+ bvs[bv] = i
+ regionInclusion[r] = uint8(bvs[bv])
+ }
+ for r := 1; r < len(b.region.s); r++ {
+ if _, ok := b.groups[r]; !ok {
+ bv := uint64(0)
+ for _, g := range mm[r] {
+ bv |= 1 << g
+ }
+ if bv == 0 {
+ // Pick the world for unspecified regions.
+ bv = 1 << b.groups[b.region.index("001")]
+ }
+ if _, ok := bvs[bv]; !ok {
+ bvs[bv] = index(len(bvs))
+ }
+ regionInclusion[r] = uint8(bvs[bv])
+ }
+ }
+ b.writeSlice("regionInclusion", regionInclusion)
+ regionInclusionBits := make([]uint64, len(bvs))
+ for k, v := range bvs {
+ regionInclusionBits[v] = uint64(k)
+ }
+ // Add bit vectors for increasingly large distances until a fixed point is reached.
+ regionInclusionNext := []uint8{}
+ for i := 0; i < len(regionInclusionBits); i++ {
+ bits := regionInclusionBits[i]
+ next := bits
+ for i := uint(0); i < uint(len(b.groups)); i++ {
+ if bits&(1<<i) != 0 {
+ next |= regionInclusionBits[i]
+ }
+ }
+ if _, ok := bvs[next]; !ok {
+ bvs[next] = index(len(bvs))
+ regionInclusionBits = append(regionInclusionBits, next)
+ }
+ regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
+ }
+ b.writeSlice("regionInclusionBits", regionInclusionBits)
+ b.writeSlice("regionInclusionNext", regionInclusionNext)
+}
+
+type parentRel struct {
+ lang uint16
+ script uint8
+ maxScript uint8
+ toRegion uint16
+ fromRegion []uint16
+}
+
+func (b *builder) writeParents() {
+ b.writeType(parentRel{})
+
+ parents := []parentRel{}
+
+ // Construct parent overrides.
+ n := 0
+ for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
+ // Skipping non-standard scripts to root is implemented using addTags.
+ if p.Parent == "root" {
+ continue
+ }
+
+ sub := strings.Split(p.Parent, "_")
+ parent := parentRel{lang: b.langIndex(sub[0])}
+ if len(sub) == 2 {
+ // TODO: check that all undefined scripts are indeed Latn in these
+ // cases.
+ parent.maxScript = uint8(b.script.index("Latn"))
+ parent.toRegion = uint16(b.region.index(sub[1]))
+ } else {
+ parent.script = uint8(b.script.index(sub[1]))
+ parent.maxScript = parent.script
+ parent.toRegion = uint16(b.region.index(sub[2]))
+ }
+ for _, c := range strings.Split(p.Locales, " ") {
+ region := b.region.index(c[strings.LastIndex(c, "_")+1:])
+ parent.fromRegion = append(parent.fromRegion, uint16(region))
+ }
+ parents = append(parents, parent)
+ n += len(parent.fromRegion)
+ }
+ b.writeSliceAddSize("parents", n*2, parents)
+}
+
+func main() {
+ gen.Init()
+
+ gen.Repackage("gen_common.go", "common.go", "language")
+
+ w := gen.NewCodeWriter()
+ defer w.WriteGoFile("tables.go", "language")
+
+ fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
+
+ b := newBuilder(w)
+ gen.WriteCLDRVersion(w)
+
+ b.parseIndices()
+ b.writeType(FromTo{})
+ b.writeLanguage()
+ b.writeScript()
+ b.writeRegion()
+ b.writeVariant()
+ // TODO: b.writeLocale()
+ b.computeRegionGroups()
+ b.writeLikelyData()
+ b.writeRegionInclusionData()
+ b.writeParents()
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/gen_common.go b/src/dma/vendor/golang.org/x/text/internal/language/gen_common.go
new file mode 100644
index 00000000..c419ceeb
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/gen_common.go
@@ -0,0 +1,20 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+ Deprecated AliasType = iota
+ Macro
+ Legacy
+
+ AliasTypeUnknown AliasType = -1
+)
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/language.go b/src/dma/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 00000000..1e74d1af
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,596 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "errors"
+ "fmt"
+ "strings"
+)
+
+const (
+ // maxCoreSize is the maximum size of a BCP 47 tag without variants and
+ // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+ maxCoreSize = 12
+
+ // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+ // is large enough to hold at least 99% of the BCP 47 tags.
+ max99thPercentileSize = 32
+
+ // maxSimpleUExtensionSize is the maximum size of a -u extension with one
+ // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+ maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+ // TODO: the following fields have the form TagTypeID. This name is chosen
+ // to allow refactoring the public package without conflicting with its
+ // Base, Script, and Region methods. Once the transition is fully completed
+ // the ID can be stripped from the name.
+
+ LangID Language
+ RegionID Region
+ // TODO: we will soon run out of positions for ScriptID. Idea: instead of
+ // storing lang, region, and ScriptID codes, store only the compact index and
+ // have a lookup table from this code to its expansion. This greatly speeds
+ // up table lookup, speed up common variant cases.
+ // This will also immediately free up 3 extra bytes. Also, the pVariant
+ // field can now be moved to the lookup table, as the compact index uniquely
+ // determines the offset of a possible variant.
+ ScriptID Script
+ pVariant byte // offset in str, includes preceding '-'
+ pExt uint16 // offset of first extension, includes preceding '-'
+
+ // str is the string representation of the Tag. It will only be used if the
+ // tag has variants or extensions.
+ str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ t, _ := Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+ return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+ return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if int(t.pVariant) < len(t.str) {
+ return false
+ }
+ return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+ return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+ if t.str == "" {
+ return
+ }
+ extra := t.str[t.pVariant:]
+ if t.pVariant > 0 {
+ extra = extra[1:]
+ }
+ if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+ t.str = extra
+ t.pVariant = 0
+ t.pExt = 0
+ return
+ }
+ var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+ b := buf[:t.genCoreBytes(buf[:])]
+ if extra != "" {
+ diff := len(b) - int(t.pVariant)
+ b = append(b, '-')
+ b = append(b, extra...)
+ t.pVariant = uint8(int(t.pVariant) + diff)
+ t.pExt = uint16(int(t.pExt) + diff)
+ } else {
+ t.pVariant = uint8(len(b))
+ t.pExt = uint16(len(b))
+ }
+ t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+ n := t.LangID.StringToBuf(buf[:])
+ if t.ScriptID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.ScriptID.String())
+ }
+ if t.RegionID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.RegionID.String())
+ }
+ return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ if t.str != "" {
+ return t.str
+ }
+ if t.ScriptID == 0 && t.RegionID == 0 {
+ return t.LangID.String()
+ }
+ buf := [maxCoreSize]byte{}
+ return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ if t.str != "" {
+ text = append(text, t.str...)
+ } else if t.ScriptID == 0 && t.RegionID == 0 {
+ text = append(text, t.LangID.String()...)
+ } else {
+ buf := [maxCoreSize]byte{}
+ text = buf[:t.genCoreBytes(buf[:])]
+ }
+ return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ tag, err := Parse(string(text))
+ *t = tag
+ return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+ if t.pVariant == 0 {
+ return ""
+ }
+ return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+ if t.pExt > 0 {
+ return t.str[t.pVariant:t.pExt]
+ }
+ return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+ return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.str != "" {
+ // Strip the variants and extensions.
+ b, s, r := t.Raw()
+ t = Tag{LangID: b, ScriptID: s, RegionID: r}
+ if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID == t.ScriptID {
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return t
+ }
+ if t.LangID != 0 {
+ if t.RegionID != 0 {
+ maxScript := t.ScriptID
+ if maxScript == 0 {
+ max, _ := addTags(t)
+ maxScript = max.ScriptID
+ }
+
+ for i := range parents {
+ if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+ for _, r := range parents[i].fromRegion {
+ if Region(r) == t.RegionID {
+ return Tag{
+ LangID: t.LangID,
+ ScriptID: Script(parents[i].script),
+ RegionID: Region(parents[i].toRegion),
+ }
+ }
+ }
+ }
+ }
+
+ // Strip the script if it is the default one.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != maxScript {
+ return Tag{LangID: t.LangID, ScriptID: maxScript}
+ }
+ return Tag{LangID: t.LangID}
+ } else if t.ScriptID != 0 {
+ // The parent for an base-script pair with a non-default script is
+ // "und" instead of the base language.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != t.ScriptID {
+ return Und
+ }
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+ scan := makeScannerString(s)
+ var end int
+ if n := len(scan.token); n != 1 {
+ return "", ErrSyntax
+ }
+ scan.toLower(0, len(scan.b))
+ end = parseExtension(&scan)
+ if end != len(s) {
+ return "", ErrSyntax
+ }
+ return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+ return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+ return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ if ext[0] == x {
+ return ext, true
+ }
+ }
+ return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+ e := []string{}
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ e = append(e, ext)
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+ if start, end, _ := t.findTypeForKey(key); end != start {
+ return t.str[start:end]
+ }
+ return ""
+}
+
+var (
+ errPrivateUse = errors.New("cannot set a key on a private use tag")
+ errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ if t.IsPrivateUse() {
+ return t, errPrivateUse
+ }
+ if len(key) != 2 {
+ return t, errInvalidArguments
+ }
+
+ // Remove the setting if value is "".
+ if value == "" {
+ start, end, _ := t.findTypeForKey(key)
+ if start != end {
+ // Remove key tag and leading '-'.
+ start -= 4
+
+ // Remove a possible empty extension.
+ if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+ start -= 2
+ }
+ if start == int(t.pVariant) && end == len(t.str) {
+ t.str = ""
+ t.pVariant, t.pExt = 0, 0
+ } else {
+ t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+ }
+ }
+ return t, nil
+ }
+
+ if len(value) < 3 || len(value) > 8 {
+ return t, errInvalidArguments
+ }
+
+ var (
+ buf [maxCoreSize + maxSimpleUExtensionSize]byte
+ uStart int // start of the -u extension.
+ )
+
+ // Generate the tag string if needed.
+ if t.str == "" {
+ uStart = t.genCoreBytes(buf[:])
+ buf[uStart] = '-'
+ uStart++
+ }
+
+ // Create new key-type pair and parse it to verify.
+ b := buf[uStart:]
+ copy(b, "u-")
+ copy(b[2:], key)
+ b[4] = '-'
+ b = b[:5+copy(b[5:], value)]
+ scan := makeScanner(b)
+ if parseExtensions(&scan); scan.err != nil {
+ return t, scan.err
+ }
+
+ // Assemble the replacement string.
+ if t.str == "" {
+ t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+ t.str = string(buf[:uStart+len(b)])
+ } else {
+ s := t.str
+ start, end, hasExt := t.findTypeForKey(key)
+ if start == end {
+ if hasExt {
+ b = b[2:]
+ }
+ t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+ } else {
+ t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+ }
+ }
+ return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+ p := int(t.pExt)
+ if len(key) != 2 || p == len(t.str) || p == 0 {
+ return p, p, false
+ }
+ s := t.str
+
+ // Find the correct extension.
+ for p++; s[p] != 'u'; p++ {
+ if s[p] > 'u' {
+ p--
+ return p, p, false
+ }
+ if p = nextExtension(s, p); p == len(s) {
+ return len(s), len(s), false
+ }
+ }
+ // Proceed to the hyphen following the extension name.
+ p++
+
+ // curKey is the key currently being processed.
+ curKey := ""
+
+ // Iterate over keys until we get the end of a section.
+ for {
+ // p points to the hyphen preceding the current token.
+ if p3 := p + 3; s[p3] == '-' {
+ // Found a key.
+ // Check whether we just processed the key that was requested.
+ if curKey == key {
+ return start, p, true
+ }
+ // Set to the next key and continue scanning type tokens.
+ curKey = s[p+1 : p3]
+ if curKey > key {
+ return p, p, true
+ }
+ // Start of the type token sequence.
+ start = p + 4
+ // A type is at least 3 characters long.
+ p += 7 // 4 + 3
+ } else {
+ // Attribute or type, which is at least 3 characters long.
+ p += 4
+ }
+ // p points past the third character of a type or attribute.
+ max := p + 5 // maximum length of token plus hyphen.
+ if len(s) < max {
+ max = len(s)
+ }
+ for ; p < max && s[p] != '-'; p++ {
+ }
+ // Bail if we have exhausted all tokens or if the next token starts
+ // a new extension.
+ if p == len(s) || s[p+2] == '-' {
+ if curKey == key {
+ return start, p, true
+ }
+ return p, p, true
+ }
+ }
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Language, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+ if len(s) != 4 {
+ return 0, ErrSyntax
+ }
+ var buf [4]byte
+ return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+ return false
+ }
+ return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ if r == 0 {
+ return false
+ }
+ return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ if r == c {
+ return true
+ }
+ g := regionInclusion[r]
+ if g >= nRegionGroups {
+ return false
+ }
+ m := regionContainment[g]
+
+ d := regionInclusion[c]
+ b := regionInclusionBits[d]
+
+ // A contained country may belong to multiple disjoint groups. Matching any
+ // of these indicates containment. If the contained region is a group, it
+ // must strictly be a subset.
+ if d >= nRegionGroups {
+ return b&m != 0
+ }
+ return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+ // difference between ISO 3166-1 and IANA ccTLD.
+ if r == _GB {
+ r = _UK
+ }
+ if (r.typ() & ccTLD) == 0 {
+ return 0, errNoTLD
+ }
+ return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ if cr := normRegion(r); cr != 0 {
+ return cr
+ }
+ return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ ID uint8
+ str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+ s = strings.ToLower(s)
+ if id, ok := variantIndex[s]; ok {
+ return Variant{id, s}, nil
+ }
+ return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.str
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/lookup.go b/src/dma/vendor/golang.org/x/text/internal/language/lookup.go
new file mode 100644
index 00000000..6294b815
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/lookup.go
@@ -0,0 +1,412 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "fmt"
+ "sort"
+ "strconv"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+ if !tag.FixCase(form, key) {
+ return 0, ErrSyntax
+ }
+ i := idx.Index(key)
+ if i == -1 {
+ return 0, NewValueError(key)
+ }
+ return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+ return sort.Search(len(imap), func(i int) bool {
+ return imap[i] >= key
+ })
+}
+
+type Language uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (Language, error) {
+ if len(s) == 2 {
+ return getLangISO2(s)
+ }
+ return getLangISO3(s)
+}
+
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+ return normLang(id)
+}
+
+// mapLang returns the mapped langID of id according to mapping m.
+func normLang(id Language) (Language, AliasType) {
+ k := sort.Search(len(AliasMap), func(i int) bool {
+ return AliasMap[i].From >= uint16(id)
+ })
+ if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+ return Language(AliasMap[k].To), AliasTypes[k]
+ }
+ return id, AliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (Language, error) {
+ if !tag.FixCase("zz", s) {
+ return 0, ErrSyntax
+ }
+ if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+ return Language(i), nil
+ }
+ return 0, NewValueError(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+ v := uint(0)
+ for i := 0; i < len(s); i++ {
+ v *= base
+ v += uint(s[i] - 'a')
+ }
+ return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+ for i := len(s) - 1; i >= 0; i-- {
+ s[i] = byte(v%base) + 'a'
+ v /= base
+ }
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (Language, error) {
+ if tag.FixCase("und", s) {
+ // first try to match canonical 3-letter entries
+ for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+ if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+ // We treat "und" as special and always translate it to "unspecified".
+ // Note that ZZ and Zzzz are private use and are not treated as
+ // unspecified by default.
+ id := Language(i)
+ if id == nonCanonicalUnd {
+ return 0, nil
+ }
+ return id, nil
+ }
+ }
+ if i := altLangISO3.Index(s); i != -1 {
+ return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+ }
+ n := strToInt(s)
+ if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+ return Language(n) + langNoIndexOffset, nil
+ }
+ // Check for non-canonical uses of ISO3.
+ for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+ if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Language(i), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+// StringToBuf writes the string to b and returns the number of bytes
+// written. cap(b) must be >= 3.
+func (id Language) StringToBuf(b []byte) int {
+ if id >= langNoIndexOffset {
+ intToStr(uint(id)-langNoIndexOffset, b[:3])
+ return 3
+ } else if id == 0 {
+ return copy(b, "und")
+ }
+ l := lang[id<<2:]
+ if l[3] == 0 {
+ return copy(b, l[:3])
+ }
+ return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b Language) String() string {
+ if b == 0 {
+ return "und"
+ } else if b >= langNoIndexOffset {
+ b -= langNoIndexOffset
+ buf := [3]byte{}
+ intToStr(uint(b), buf[:])
+ return string(buf[:])
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ }
+ return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Language) ISO3() string {
+ if b == 0 || b >= langNoIndexOffset {
+ return b.String()
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ } else if l[2] == 0 {
+ return altLangISO3.Elem(int(l[3]))[:3]
+ }
+ // This allocation will only happen for 3-letter ISO codes
+ // that are non-canonical BCP 47 language identifiers.
+ return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Language) IsPrivateUse() bool {
+ return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+ if b < langNoIndexOffset {
+ return Script(suppressScript[b])
+ }
+ return 0
+}
+
+type Region uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (Region, error) {
+ if len(s) == 3 {
+ if isAlpha(s[0]) {
+ return getRegionISO3(s)
+ }
+ if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+ return getRegionM49(int(i))
+ }
+ }
+ return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (Region, error) {
+ i, err := findIndex(regionISO, s, "ZZ")
+ if err != nil {
+ return 0, err
+ }
+ return Region(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (Region, error) {
+ if tag.FixCase("ZZZ", s) {
+ for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+ if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Region(i) + isoRegionOffset, nil
+ }
+ }
+ for i := 0; i < len(altRegionISO3); i += 3 {
+ if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+ return Region(altRegionIDs[i/3]), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+func getRegionM49(n int) (Region, error) {
+ if 0 < n && n <= 999 {
+ const (
+ searchBits = 7
+ regionBits = 9
+ regionMask = 1<<regionBits - 1
+ )
+ idx := n >> searchBits
+ buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+ val := uint16(n) << regionBits // we rely on bits shifting out
+ i := sort.Search(len(buf), func(i int) bool {
+ return buf[i] >= val
+ })
+ if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+ return Region(r & regionMask), nil
+ }
+ }
+ var e ValueError
+ fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+ return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r Region) Region {
+ m := regionOldMap
+ k := sort.Search(len(m), func(i int) bool {
+ return m[i].From >= uint16(r)
+ })
+ if k < len(m) && m[k].From == uint16(r) {
+ return Region(m[k].To)
+ }
+ return 0
+}
+
+const (
+ iso3166UserAssigned = 1 << iota
+ ccTLD
+ bcp47Region
+)
+
+func (r Region) typ() byte {
+ return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ if r < isoRegionOffset {
+ if r == 0 {
+ return "ZZ"
+ }
+ return fmt.Sprintf("%03d", r.M49())
+ }
+ r -= isoRegionOffset
+ return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ if r < isoRegionOffset {
+ return "ZZZ"
+ }
+ r -= isoRegionOffset
+ reg := regionISO.Elem(int(r))
+ switch reg[2] {
+ case 0:
+ return altRegionISO3[reg[3]:][:3]
+ case ' ':
+ return "ZZZ"
+ }
+ return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.typ()&iso3166UserAssigned != 0
+}
+
+type Script uint8
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
+ i, err := findIndex(idx, s, "Zzzz")
+ return Script(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ if s == 0 {
+ return "Zzzz"
+ }
+ return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+ maxAltTaglen = len("en-US-POSIX")
+ maxLen = maxAltTaglen
+)
+
+var (
+ // grandfatheredMap holds a mapping from legacy and grandfathered tags to
+ // their base language or index to more elaborate tag.
+ grandfatheredMap = map[[maxLen]byte]int16{
+ [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+ [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami
+ [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn
+ [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak
+ [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon
+ [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux
+ [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo
+ [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn
+ [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao
+ [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay
+ [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu
+ [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok
+ [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL
+ [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE
+ [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu
+ [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+ [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang
+
+ // Grandfathered tags with no modern replacement will be converted as
+ // follows:
+ [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+ [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed
+ [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default
+ [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian
+ [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min
+
+ // CLDR-specific tag.
+ [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root
+ [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+ }
+
+ altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+ altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+ if v, ok := grandfatheredMap[s]; ok {
+ if v < 0 {
+ return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+ }
+ t.LangID = Language(v)
+ return t, true
+ }
+ return t, false
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/match.go b/src/dma/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 00000000..75a2dbca
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+ if t.LangID == 0 {
+ t.LangID = id
+ }
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+ if t.ScriptID == 0 {
+ t.ScriptID = id
+ }
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+ if t.RegionID == 0 || t.RegionID.Contains(id) {
+ t.RegionID = id
+ }
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value. It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+ id, err := addTags(t)
+ if err != nil {
+ return t, err
+ } else if id.equalTags(t) {
+ return t, nil
+ }
+ id.RemakeString()
+ return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+ t.RegionID = Region(x.region)
+ }
+ return true
+ }
+ return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+ return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+ // We leave private use identifiers alone.
+ if t.IsPrivateUse() {
+ return t, nil
+ }
+ if t.ScriptID != 0 && t.RegionID != 0 {
+ if t.LangID != 0 {
+ // already fully specified
+ specializeRegion(&t)
+ return t, nil
+ }
+ // Search matches for und-script-region. Note that for these cases
+ // region will never be a group so there is no need to check for this.
+ list := likelyRegion[t.RegionID : t.RegionID+1]
+ if x := list[0]; x.flags&isList != 0 {
+ list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+ }
+ for _, x := range list {
+ // Deviating from the spec. See match_test.go for details.
+ if Script(x.script) == t.ScriptID {
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ }
+ if t.LangID != 0 {
+ // Search matches for lang-script and lang-region, where lang != und.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ list := likelyLangList[x.region : x.region+uint16(x.script)]
+ if t.ScriptID != 0 {
+ for _, x := range list {
+ if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ return t, nil
+ }
+ }
+ } else if t.RegionID != 0 {
+ count := 0
+ goodScript := true
+ tt := t
+ for _, x := range list {
+ // We visit all entries for which the script was not
+ // defined, including the ones where the region was not
+ // defined. This allows for proper disambiguation within
+ // regions.
+ if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+ tt.RegionID = Region(x.region)
+ tt.setUndefinedScript(Script(x.script))
+ goodScript = goodScript && tt.ScriptID == Script(x.script)
+ count++
+ }
+ }
+ if count == 1 {
+ return tt, nil
+ }
+ // Even if we fail to find a unique Region, we might have
+ // an unambiguous script.
+ if goodScript {
+ t.ScriptID = tt.ScriptID
+ }
+ }
+ }
+ }
+ } else {
+ // Search matches for und-script.
+ if t.ScriptID != 0 {
+ x := likelyScript[t.ScriptID]
+ if x.region != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ // Search matches for und-region. If und-script-region exists, it would
+ // have been found earlier.
+ if t.RegionID != 0 {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if x.region != 0 {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ t.RegionID = Region(x.region)
+ }
+ } else {
+ x := likelyRegion[t.RegionID]
+ if x.flags&isList != 0 {
+ x = likelyRegionList[x.lang]
+ }
+ if x.script != 0 && x.flags != scriptInFrom {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ return t, nil
+ }
+ }
+ }
+ }
+
+ // Search matches for lang.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ x = likelyLangList[x.region]
+ }
+ if x.region != 0 {
+ t.setUndefinedScript(Script(x.script))
+ t.setUndefinedRegion(Region(x.region))
+ }
+ specializeRegion(&t)
+ if t.LangID == 0 {
+ t.LangID = _en // default language
+ }
+ return t, nil
+ }
+ return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+ t.LangID = id.LangID
+ t.ScriptID = id.ScriptID
+ t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+ t, err := minimizeTags(t)
+ if err != nil {
+ return t, err
+ }
+ t.RemakeString()
+ return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+ if t.equalTags(Und) {
+ return t, nil
+ }
+ max, err := addTags(t)
+ if err != nil {
+ return t, err
+ }
+ for _, id := range [...]Tag{
+ {LangID: t.LangID},
+ {LangID: t.LangID, RegionID: t.RegionID},
+ {LangID: t.LangID, ScriptID: t.ScriptID},
+ } {
+ if x, err := addTags(id); err == nil && max.equalTags(x) {
+ t.setTagsFrom(id)
+ break
+ }
+ }
+ return t, nil
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/parse.go b/src/dma/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 00000000..2be83e1d
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,594 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+ return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+ for _, c := range s {
+ if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+ return false
+ }
+ }
+ return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+ v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+ var e ValueError
+ copy(e.v[:], tag)
+ return e
+}
+
+func (e ValueError) tag() []byte {
+ n := bytes.IndexByte(e.v[:], 0)
+ if n == -1 {
+ n = 8
+ }
+ return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+ return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+ return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+ b []byte
+ bytes [max99thPercentileSize]byte
+ token []byte
+ start int // start position of the current token
+ end int // end position of the current token
+ next int // next point for scan
+ err error
+ done bool
+}
+
+func makeScannerString(s string) scanner {
+ scan := scanner{}
+ if len(s) <= len(scan.bytes) {
+ scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+ } else {
+ scan.b = []byte(s)
+ }
+ scan.init()
+ return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+ scan := scanner{b: b}
+ scan.init()
+ return scan
+}
+
+func (s *scanner) init() {
+ for i, c := range s.b {
+ if c == '_' {
+ s.b[i] = '-'
+ }
+ }
+ s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+ for i := start; i < end; i++ {
+ c := s.b[i]
+ if 'A' <= c && c <= 'Z' {
+ s.b[i] += 'a' - 'A'
+ }
+ }
+}
+
+func (s *scanner) setError(e error) {
+ if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+ s.err = e
+ }
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+ s.start = oldStart
+ if end := oldStart + newSize; end != oldEnd {
+ diff := end - oldEnd
+ if end < cap(s.b) {
+ b := make([]byte, len(s.b)+diff)
+ copy(b, s.b[:oldStart])
+ copy(b[end:], s.b[oldEnd:])
+ s.b = b
+ } else {
+ s.b = append(s.b[end:], s.b[oldEnd:]...)
+ }
+ s.next = end + (s.next - s.end)
+ s.end = end
+ }
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+ s.resizeRange(s.start, s.end, len(repl))
+ copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+ s.setError(e)
+ if s.start == 0 {
+ s.b = s.b[:+copy(s.b, s.b[s.next:])]
+ s.end = 0
+ } else {
+ s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+ s.end = s.start - 1
+ }
+ s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+ s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+ diff := end - start
+ s.next -= diff
+ s.start -= diff
+ s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string. Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+ end = s.end
+ s.token = nil
+ for s.start = s.next; s.next < len(s.b); {
+ i := bytes.IndexByte(s.b[s.next:], '-')
+ if i == -1 {
+ s.end = len(s.b)
+ s.next = len(s.b)
+ i = s.end - s.start
+ } else {
+ s.end = s.next + i
+ s.next = s.end + 1
+ }
+ token := s.b[s.start:s.end]
+ if i < 1 || i > 8 || !isAlphaNum(token) {
+ s.gobble(ErrSyntax)
+ continue
+ }
+ s.token = token
+ return end
+ }
+ if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+ s.setError(ErrSyntax)
+ s.b = s.b[:len(s.b)-1]
+ }
+ s.done = true
+ return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+ end = s.end
+ s.scan()
+ for ; len(s.token) >= min; s.scan() {
+ end = s.end
+ }
+ return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+ // TODO: consider supporting old-style locale key-value pairs.
+ if s == "" {
+ return Und, ErrSyntax
+ }
+ if len(s) <= maxAltTaglen {
+ b := [maxAltTaglen]byte{}
+ for i, c := range s {
+ // Generating invalid UTF-8 is okay as it won't match.
+ if 'A' <= c && c <= 'Z' {
+ c += 'a' - 'A'
+ } else if c == '_' {
+ c = '-'
+ }
+ b[i] = byte(c)
+ }
+ if t, ok := grandfathered(b); ok {
+ return t, nil
+ }
+ }
+ scan := makeScannerString(s)
+ return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+ t = Und
+ var end int
+ if n := len(scan.token); n <= 1 {
+ scan.toLower(0, len(scan.b))
+ if n == 0 || scan.token[0] != 'x' {
+ return t, ErrSyntax
+ }
+ end = parseExtensions(scan)
+ } else if n >= 4 {
+ return Und, ErrSyntax
+ } else { // the usual case
+ t, end = parseTag(scan)
+ if n := len(scan.token); n == 1 {
+ t.pExt = uint16(end)
+ end = parseExtensions(scan)
+ } else if end < len(scan.b) {
+ scan.setError(ErrSyntax)
+ scan.b = scan.b[:end]
+ }
+ }
+ if int(t.pVariant) < len(scan.b) {
+ if end < len(s) {
+ s = s[:end]
+ }
+ if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+ t.str = s
+ } else {
+ t.str = string(scan.b)
+ }
+ } else {
+ t.pVariant, t.pExt = 0, 0
+ }
+ return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+ var e error
+ // TODO: set an error if an unknown lang, script or region is encountered.
+ t.LangID, e = getLangID(scan.token)
+ scan.setError(e)
+ scan.replace(t.LangID.String())
+ langStart := scan.start
+ end = scan.scan()
+ for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+ // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+ // to a tag of the form <extlang>.
+ lang, e := getLangID(scan.token)
+ if lang != 0 {
+ t.LangID = lang
+ copy(scan.b[langStart:], lang.String())
+ scan.b[langStart+3] = '-'
+ scan.start = langStart + 4
+ }
+ scan.gobble(e)
+ end = scan.scan()
+ }
+ if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+ t.ScriptID, e = getScriptID(script, scan.token)
+ if t.ScriptID == 0 {
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if n := len(scan.token); n >= 2 && n <= 3 {
+ t.RegionID, e = getRegionID(scan.token)
+ if t.RegionID == 0 {
+ scan.gobble(e)
+ } else {
+ scan.replace(t.RegionID.String())
+ }
+ end = scan.scan()
+ }
+ scan.toLower(scan.start, len(scan.b))
+ t.pVariant = byte(end)
+ end = parseVariants(scan, end, t)
+ t.pExt = uint16(end)
+ return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+ start := scan.start
+ varIDBuf := [4]uint8{}
+ variantBuf := [4][]byte{}
+ varID := varIDBuf[:0]
+ variant := variantBuf[:0]
+ last := -1
+ needSort := false
+ for ; len(scan.token) >= 4; scan.scan() {
+ // TODO: measure the impact of needing this conversion and redesign
+ // the data structure if there is an issue.
+ v, ok := variantIndex[string(scan.token)]
+ if !ok {
+ // unknown variant
+ // TODO: allow user-defined variants?
+ scan.gobble(NewValueError(scan.token))
+ continue
+ }
+ varID = append(varID, v)
+ variant = append(variant, scan.token)
+ if !needSort {
+ if last < int(v) {
+ last = int(v)
+ } else {
+ needSort = true
+ // There is no legal combinations of more than 7 variants
+ // (and this is by no means a useful sequence).
+ const maxVariants = 8
+ if len(varID) > maxVariants {
+ break
+ }
+ }
+ }
+ end = scan.end
+ }
+ if needSort {
+ sort.Sort(variantsSort{varID, variant})
+ k, l := 0, -1
+ for i, v := range varID {
+ w := int(v)
+ if l == w {
+ // Remove duplicates.
+ continue
+ }
+ varID[k] = varID[i]
+ variant[k] = variant[i]
+ k++
+ l = w
+ }
+ if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+ end = start - 1
+ } else {
+ scan.resizeRange(start, end, len(str))
+ copy(scan.b[scan.start:], str)
+ end = scan.end
+ }
+ }
+ return end
+}
+
+type variantsSort struct {
+ i []uint8
+ v [][]byte
+}
+
+func (s variantsSort) Len() int {
+ return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+ s.i[i], s.i[j] = s.i[j], s.i[i]
+ s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+ return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+ b [][]byte
+ n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+ return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+ b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+ for k := 0; k < b.n; k++ {
+ if b.b[i][k] == b.b[j][k] {
+ continue
+ }
+ return b.b[i][k] < b.b[j][k]
+ }
+ return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+ start := scan.start
+ exts := [][]byte{}
+ private := []byte{}
+ end := scan.end
+ for len(scan.token) == 1 {
+ extStart := scan.start
+ ext := scan.token[0]
+ end = parseExtension(scan)
+ extension := scan.b[extStart:end]
+ if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+ scan.setError(ErrSyntax)
+ end = extStart
+ continue
+ } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+ scan.b = scan.b[:end]
+ return end
+ } else if ext == 'x' {
+ private = extension
+ break
+ }
+ exts = append(exts, extension)
+ }
+ sort.Sort(bytesSort{exts, 1})
+ if len(private) > 0 {
+ exts = append(exts, private)
+ }
+ scan.b = scan.b[:start]
+ if len(exts) > 0 {
+ scan.b = append(scan.b, bytes.Join(exts, separator)...)
+ } else if start > 0 {
+ // Strip trailing '-'.
+ scan.b = scan.b[:start-1]
+ }
+ return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+ start, end := scan.start, scan.end
+ switch scan.token[0] {
+ case 'u':
+ attrStart := end
+ scan.scan()
+ for last := []byte{}; len(scan.token) > 2; scan.scan() {
+ if bytes.Compare(scan.token, last) != -1 {
+ // Attributes are unsorted. Start over from scratch.
+ p := attrStart + 1
+ scan.next = p
+ attrs := [][]byte{}
+ for scan.scan(); len(scan.token) > 2; scan.scan() {
+ attrs = append(attrs, scan.token)
+ end = scan.end
+ }
+ sort.Sort(bytesSort{attrs, 3})
+ copy(scan.b[p:], bytes.Join(attrs, separator))
+ break
+ }
+ last = scan.token
+ end = scan.end
+ }
+ var last, key []byte
+ for attrEnd := end; len(scan.token) == 2; last = key {
+ key = scan.token
+ keyEnd := scan.end
+ end = scan.acceptMinSize(3)
+ // TODO: check key value validity
+ if keyEnd == end || bytes.Compare(key, last) != 1 {
+ // We have an invalid key or the keys are not sorted.
+ // Start scanning keys from scratch and reorder.
+ p := attrEnd + 1
+ scan.next = p
+ keys := [][]byte{}
+ for scan.scan(); len(scan.token) == 2; {
+ keyStart, keyEnd := scan.start, scan.end
+ end = scan.acceptMinSize(3)
+ if keyEnd != end {
+ keys = append(keys, scan.b[keyStart:end])
+ } else {
+ scan.setError(ErrSyntax)
+ end = keyStart
+ }
+ }
+ sort.Stable(bytesSort{keys, 2})
+ if n := len(keys); n > 0 {
+ k := 0
+ for i := 1; i < n; i++ {
+ if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+ k++
+ keys[k] = keys[i]
+ } else if !bytes.Equal(keys[k], keys[i]) {
+ scan.setError(ErrDuplicateKey)
+ }
+ }
+ keys = keys[:k+1]
+ }
+ reordered := bytes.Join(keys, separator)
+ if e := p + len(reordered); e < end {
+ scan.deleteRange(e, end)
+ end = e
+ }
+ copy(scan.b[p:], reordered)
+ break
+ }
+ }
+ case 't':
+ scan.scan()
+ if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+ _, end = parseTag(scan)
+ scan.toLower(start, end)
+ }
+ for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+ end = scan.acceptMinSize(3)
+ }
+ case 'x':
+ end = scan.acceptMinSize(1)
+ default:
+ end = scan.acceptMinSize(2)
+ }
+ return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+ if s[p] == '-' {
+ p++
+ }
+ if s[p] == 'x' {
+ return len(s), s[p:]
+ }
+ end = nextExtension(s, p)
+ return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+ for n := len(s) - 3; p < n; {
+ if s[p] == '-' {
+ if s[p+2] == '-' {
+ return p
+ }
+ p += 3
+ } else {
+ p++
+ }
+ }
+ return len(s)
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/tables.go b/src/dma/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 00000000..239e2d29
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3431 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8665
+
+const NumScripts = 242
+
+const NumRegions = 357
+
+type FromTo struct {
+ From uint16
+ To uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+ _af = 22
+ _am = 39
+ _ar = 58
+ _az = 88
+ _bg = 126
+ _bn = 165
+ _ca = 215
+ _cs = 250
+ _da = 257
+ _de = 269
+ _el = 310
+ _en = 313
+ _es = 318
+ _et = 320
+ _fa = 328
+ _fi = 337
+ _fil = 339
+ _fr = 350
+ _gu = 420
+ _he = 444
+ _hi = 446
+ _hr = 465
+ _hu = 469
+ _hy = 471
+ _id = 481
+ _is = 504
+ _it = 505
+ _ja = 512
+ _ka = 528
+ _kk = 578
+ _km = 586
+ _kn = 593
+ _ko = 596
+ _ky = 650
+ _lo = 696
+ _lt = 704
+ _lv = 711
+ _mk = 767
+ _ml = 772
+ _mn = 779
+ _mo = 784
+ _mr = 795
+ _ms = 799
+ _mul = 806
+ _my = 817
+ _nb = 839
+ _ne = 849
+ _nl = 871
+ _no = 879
+ _pa = 925
+ _pl = 947
+ _pt = 960
+ _ro = 988
+ _ru = 994
+ _sh = 1031
+ _si = 1036
+ _sk = 1042
+ _sl = 1046
+ _sq = 1073
+ _sr = 1074
+ _sv = 1092
+ _sw = 1093
+ _ta = 1104
+ _te = 1121
+ _th = 1131
+ _tl = 1146
+ _tn = 1152
+ _tr = 1162
+ _uk = 1198
+ _ur = 1204
+ _uz = 1212
+ _vi = 1219
+ _zh = 1321
+ _zu = 1327
+ _jbo = 515
+ _ami = 1650
+ _bnn = 2357
+ _hak = 438
+ _tlh = 14467
+ _lb = 661
+ _nv = 899
+ _pwn = 12055
+ _tao = 14188
+ _tay = 14198
+ _tsu = 14662
+ _nn = 874
+ _sfb = 13629
+ _vgt = 15701
+ _sgg = 13660
+ _cmn = 3007
+ _nan = 835
+ _hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+// - if the first letter of the 2- and 3-letter ISO codes are the same:
+// the second and third letter of the 3-letter ISO code.
+// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+ "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+ "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+ "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+ "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+ "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+ "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+ "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+ "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+ "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+ "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+ "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+ "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+ "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+ "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+ "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+ "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+ "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+ "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+ "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+ "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+ "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+ "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+ "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+ "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+ "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+ "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+ "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+ "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+ "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+ "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+ "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+ "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+ "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+ "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+ "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+ "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+ "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+ "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+ "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+ "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+ "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+ "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+ "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+ "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+ "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+ "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+ "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+ "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+ "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+ "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+ "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+ "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+ "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+ "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+ "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+ "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+ "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+ "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+ "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+ "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+ "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+ "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+ "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+ "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+ "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+ "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+ "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+ "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+ "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+ "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+ "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+ "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+ "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+ "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+ "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+ "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+ "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+ "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+ "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+ "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+ "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+ "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+ "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+ "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+ "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+ "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+ "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+ "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+ "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+ "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+ "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+ "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+ "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+ "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+ "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+ "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+ "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+ "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+ "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+ "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+ "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+ "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+ "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+ "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+ "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+ "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+ "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+ "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+ "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+ "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+ "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+ "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+ "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+ "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+ "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+ "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+ "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+ "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+ "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+ "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+ "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+ "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+ "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+ "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+ // Entry 0 - 3F
+ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+ 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+ 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+ 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+ 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+ 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+ 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+ 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+ // Entry 40 - 7F
+ 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+ 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+ 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+ 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+ 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+ 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+ 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+ // Entry 80 - BF
+ 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+ 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+ 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+ 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+ 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+ 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+ 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+ 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+ // Entry C0 - FF
+ 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+ 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+ 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+ 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+ 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+ 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+ 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+ // Entry 100 - 13F
+ 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+ 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+ 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+ 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+ 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+ 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+ 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+ // Entry 140 - 17F
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+ 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+ 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+ 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+ 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+ 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+ 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+ 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+ // Entry 180 - 1BF
+ 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+ 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+ 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+ 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+ 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+ 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+ // Entry 200 - 23F
+ 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+ 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+ 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+ 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+ 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+ 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+ 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+ // Entry 240 - 27F
+ 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+ 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+ 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+ 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+ 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+ 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+ 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+ // Entry 280 - 2BF
+ 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+ 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+ 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+ 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+ 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+ 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+ // Entry 2C0 - 2FF
+ 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+ 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+ 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+ 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+ 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+ 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+ 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+ 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+ 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+ 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+ 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+ 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+ 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+ 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+ 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+ 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+ 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+ 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+ 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+ 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+ // Entry 380 - 3BF
+ 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+ 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+ 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+ 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+ 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+ 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+ 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+ // Entry 3C0 - 3FF
+ 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+ 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+ 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+ 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+ 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+ 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+ 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+ 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+ // Entry 400 - 43F
+ 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+ 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+ 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+ 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+ 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+ 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+ 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+ 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+ // Entry 440 - 47F
+ 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+ 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+ 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+ 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+ 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+ 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+ 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+ // Entry 480 - 4BF
+ 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+ 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+ 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+ 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+ 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+ 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+ 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+ // Entry 4C0 - 4FF
+ 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+ 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+ 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+ 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+ 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+ 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+ 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+ // Entry 500 - 53F
+ 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+ 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+ 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+ 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+ 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+ 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+ 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+ // Entry 540 - 57F
+ 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ // Entry 580 - 5BF
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+ 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+ 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+ 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+ 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+ 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+ // Entry 5C0 - 5FF
+ 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+ 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+ 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+ 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+ 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+ 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+ 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+ 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+ // Entry 600 - 63F
+ 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+ 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+ 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+ 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+ 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+ 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+ 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+ // Entry 640 - 67F
+ 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+ 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+ 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+ 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+ 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+ 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+ 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+ // Entry 680 - 6BF
+ 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+ 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+ 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+ 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+ 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+ 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+ 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+ // Entry 6C0 - 6FF
+ 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+ 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+ 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+ 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+ 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+ // Entry 700 - 73F
+ 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+ 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+ 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+ 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+ 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 740 - 77F
+ 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+ 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+ 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+ 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+ 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+ 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+ // Entry 780 - 7BF
+ 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+ 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+ 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+ 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+ 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+ 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+ 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+ 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+ // Entry 7C0 - 7FF
+ 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+ 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+ 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+ 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+ 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+ 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+ 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+ // Entry 800 - 83F
+ 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+ 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+ 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+ 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+ 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+ 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+ 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+ // Entry 840 - 87F
+ 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+ 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+ 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+ 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+ 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+ 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+ 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+ // Entry 880 - 8BF
+ 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+ 0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+ 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var AliasMap = [164]FromTo{
+ 0: {From: 0x82, To: 0x88},
+ 1: {From: 0x187, To: 0x1ae},
+ 2: {From: 0x1f3, To: 0x1e1},
+ 3: {From: 0x1fb, To: 0x1bc},
+ 4: {From: 0x208, To: 0x512},
+ 5: {From: 0x20f, To: 0x20e},
+ 6: {From: 0x310, To: 0x3dc},
+ 7: {From: 0x347, To: 0x36f},
+ 8: {From: 0x407, To: 0x432},
+ 9: {From: 0x47a, To: 0x153},
+ 10: {From: 0x490, To: 0x451},
+ 11: {From: 0x4a2, To: 0x21},
+ 12: {From: 0x53e, To: 0x544},
+ 13: {From: 0x58f, To: 0x12d},
+ 14: {From: 0x630, To: 0x1eb1},
+ 15: {From: 0x651, To: 0x431},
+ 16: {From: 0x662, To: 0x431},
+ 17: {From: 0x6ed, To: 0x3a},
+ 18: {From: 0x6f8, To: 0x1d7},
+ 19: {From: 0x73e, To: 0x21a1},
+ 20: {From: 0x7b3, To: 0x56},
+ 21: {From: 0x7b9, To: 0x299b},
+ 22: {From: 0x7c5, To: 0x58},
+ 23: {From: 0x7e6, To: 0x145},
+ 24: {From: 0x80c, To: 0x5a},
+ 25: {From: 0x815, To: 0x8d},
+ 26: {From: 0x87e, To: 0x810},
+ 27: {From: 0x8c3, To: 0xee3},
+ 28: {From: 0x9ef, To: 0x331},
+ 29: {From: 0xa36, To: 0x2c5},
+ 30: {From: 0xa3d, To: 0xbf},
+ 31: {From: 0xabe, To: 0x3322},
+ 32: {From: 0xb38, To: 0x529},
+ 33: {From: 0xb75, To: 0x265a},
+ 34: {From: 0xb7e, To: 0xbc3},
+ 35: {From: 0xb9b, To: 0x44e},
+ 36: {From: 0xbbc, To: 0x4229},
+ 37: {From: 0xbbf, To: 0x529},
+ 38: {From: 0xbfe, To: 0x2da7},
+ 39: {From: 0xc2e, To: 0x3181},
+ 40: {From: 0xcb9, To: 0xf3},
+ 41: {From: 0xd08, To: 0xfa},
+ 42: {From: 0xdc8, To: 0x11a},
+ 43: {From: 0xdd7, To: 0x32d},
+ 44: {From: 0xdf8, To: 0xdfb},
+ 45: {From: 0xdfe, To: 0x531},
+ 46: {From: 0xedf, To: 0x205a},
+ 47: {From: 0xeee, To: 0x2e9a},
+ 48: {From: 0xf39, To: 0x367},
+ 49: {From: 0x10d0, To: 0x140},
+ 50: {From: 0x1104, To: 0x2d0},
+ 51: {From: 0x11a0, To: 0x1ec},
+ 52: {From: 0x1279, To: 0x21},
+ 53: {From: 0x1424, To: 0x15e},
+ 54: {From: 0x1470, To: 0x14e},
+ 55: {From: 0x151f, To: 0xd9b},
+ 56: {From: 0x1523, To: 0x390},
+ 57: {From: 0x1532, To: 0x19f},
+ 58: {From: 0x1580, To: 0x210},
+ 59: {From: 0x1583, To: 0x10d},
+ 60: {From: 0x15a3, To: 0x3caf},
+ 61: {From: 0x166a, To: 0x19b},
+ 62: {From: 0x16c8, To: 0x136},
+ 63: {From: 0x1700, To: 0x29f8},
+ 64: {From: 0x1718, To: 0x194},
+ 65: {From: 0x1727, To: 0xf3f},
+ 66: {From: 0x177a, To: 0x178},
+ 67: {From: 0x1809, To: 0x17b6},
+ 68: {From: 0x1816, To: 0x18f3},
+ 69: {From: 0x188a, To: 0x436},
+ 70: {From: 0x1979, To: 0x1d01},
+ 71: {From: 0x1a74, To: 0x2bb0},
+ 72: {From: 0x1a8a, To: 0x1f8},
+ 73: {From: 0x1b5a, To: 0x1fa},
+ 74: {From: 0x1b86, To: 0x1515},
+ 75: {From: 0x1d64, To: 0x2c9b},
+ 76: {From: 0x2038, To: 0x37b1},
+ 77: {From: 0x203d, To: 0x20dd},
+ 78: {From: 0x205a, To: 0x30b},
+ 79: {From: 0x20e3, To: 0x274},
+ 80: {From: 0x20ee, To: 0x263},
+ 81: {From: 0x20f2, To: 0x22d},
+ 82: {From: 0x20f9, To: 0x256},
+ 83: {From: 0x210f, To: 0x21eb},
+ 84: {From: 0x2135, To: 0x27d},
+ 85: {From: 0x2160, To: 0x913},
+ 86: {From: 0x2199, To: 0x121},
+ 87: {From: 0x21ce, To: 0x1561},
+ 88: {From: 0x21e6, To: 0x504},
+ 89: {From: 0x21f4, To: 0x49f},
+ 90: {From: 0x222d, To: 0x121},
+ 91: {From: 0x2237, To: 0x121},
+ 92: {From: 0x2262, To: 0x92a},
+ 93: {From: 0x2316, To: 0x3226},
+ 94: {From: 0x2382, To: 0x3365},
+ 95: {From: 0x2472, To: 0x2c7},
+ 96: {From: 0x24e4, To: 0x2ff},
+ 97: {From: 0x24f0, To: 0x2fa},
+ 98: {From: 0x24fa, To: 0x31f},
+ 99: {From: 0x2550, To: 0xb5b},
+ 100: {From: 0x25a9, To: 0xe2},
+ 101: {From: 0x263e, To: 0x2d0},
+ 102: {From: 0x26c9, To: 0x26b4},
+ 103: {From: 0x26f9, To: 0x3c8},
+ 104: {From: 0x2727, To: 0x3caf},
+ 105: {From: 0x2765, To: 0x26b4},
+ 106: {From: 0x2789, To: 0x4358},
+ 107: {From: 0x28ef, To: 0x2837},
+ 108: {From: 0x2914, To: 0x351},
+ 109: {From: 0x2986, To: 0x2da7},
+ 110: {From: 0x2b1a, To: 0x38d},
+ 111: {From: 0x2bfc, To: 0x395},
+ 112: {From: 0x2c3f, To: 0x3caf},
+ 113: {From: 0x2cfc, To: 0x3be},
+ 114: {From: 0x2d13, To: 0x597},
+ 115: {From: 0x2d47, To: 0x148},
+ 116: {From: 0x2d48, To: 0x148},
+ 117: {From: 0x2dff, To: 0x2f1},
+ 118: {From: 0x2e08, To: 0x19cc},
+ 119: {From: 0x2e1a, To: 0x2d95},
+ 120: {From: 0x2e21, To: 0x292},
+ 121: {From: 0x2e54, To: 0x7d},
+ 122: {From: 0x2e65, To: 0x2282},
+ 123: {From: 0x2ea0, To: 0x2e9b},
+ 124: {From: 0x2eef, To: 0x2ed7},
+ 125: {From: 0x3193, To: 0x3c4},
+ 126: {From: 0x3366, To: 0x338e},
+ 127: {From: 0x342a, To: 0x3dc},
+ 128: {From: 0x34ee, To: 0x18d0},
+ 129: {From: 0x35c8, To: 0x2c9b},
+ 130: {From: 0x35e6, To: 0x412},
+ 131: {From: 0x3658, To: 0x246},
+ 132: {From: 0x3676, To: 0x3f4},
+ 133: {From: 0x36fd, To: 0x445},
+ 134: {From: 0x37c0, To: 0x121},
+ 135: {From: 0x3816, To: 0x38f2},
+ 136: {From: 0x382b, To: 0x2c9b},
+ 137: {From: 0x382f, To: 0xa9},
+ 138: {From: 0x3832, To: 0x3228},
+ 139: {From: 0x386c, To: 0x39a6},
+ 140: {From: 0x3892, To: 0x3fc0},
+ 141: {From: 0x38a5, To: 0x39d7},
+ 142: {From: 0x38b4, To: 0x1fa4},
+ 143: {From: 0x38b5, To: 0x2e9a},
+ 144: {From: 0x395c, To: 0x47e},
+ 145: {From: 0x3b4e, To: 0xd91},
+ 146: {From: 0x3b78, To: 0x137},
+ 147: {From: 0x3c99, To: 0x4bc},
+ 148: {From: 0x3fbd, To: 0x100},
+ 149: {From: 0x4208, To: 0xa91},
+ 150: {From: 0x42be, To: 0x573},
+ 151: {From: 0x42f9, To: 0x3f60},
+ 152: {From: 0x4378, To: 0x25a},
+ 153: {From: 0x43cb, To: 0x36cb},
+ 154: {From: 0x43cd, To: 0x10f},
+ 155: {From: 0x44af, To: 0x3322},
+ 156: {From: 0x44e3, To: 0x512},
+ 157: {From: 0x45ca, To: 0x2409},
+ 158: {From: 0x45dd, To: 0x26dc},
+ 159: {From: 0x4610, To: 0x48ae},
+ 160: {From: 0x46ae, To: 0x46a0},
+ 161: {From: 0x473e, To: 0x4745},
+ 162: {From: 0x4916, To: 0x31f},
+ 163: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var AliasTypes = [164]AliasType{
+ // Entry 0 - 3F
+ 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+ 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+ 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+ 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+ // Entry 40 - 7F
+ 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+ 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+ 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+ 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+ // Entry 80 - BF
+ 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+ 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+ 0, 1, 1, 1,
+}
+
+const (
+ _Latn = 87
+ _Hani = 54
+ _Hans = 56
+ _Hant = 57
+ _Qaaa = 139
+ _Qaai = 147
+ _Qabx = 188
+ _Zinh = 236
+ _Zyyy = 241
+ _Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+ "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+ "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+ "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+ "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+ "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+ "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+ "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+ "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+ "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+ "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+ "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+ "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+ "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+ "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists. If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry C0 - FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+ // Entry 140 - 17F
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 240 - 27F
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 280 - 2BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 2C0 - 2FF
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 380 - 3BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+ // Entry 3C0 - 3FF
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 400 - 43F
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ // Entry 440 - 47F
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 480 - 4BF
+ 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 4C0 - 4FF
+ 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 500 - 53F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00,
+}
+
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 110
+ _GB = 123
+ _MD = 188
+ _PT = 238
+ _UK = 306
+ _US = 309
+ _ZZ = 357
+ _XA = 323
+ _XC = 325
+ _XK = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 40 - 7F
+ 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+ 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+ 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 80 - BF
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry C0 - FF
+ 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ // Entry 100 - 13F
+ 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 140 - 17F
+ 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+ 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+// - [A-Z}{2}: the first letter of the 2-letter code plus these two
+// letters form the 3-letter ISO code.
+// - 0, n: index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+ "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+ "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+ "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+ "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+ "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" +
+ "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+ "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" +
+ "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+ "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+ "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+ "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+ "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+ "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+ "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+ "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+ "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+ "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+ "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+ "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+ "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+ 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+ 0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+ 0: {From: 0x44, To: 0xc4},
+ 1: {From: 0x58, To: 0xa7},
+ 2: {From: 0x5f, To: 0x60},
+ 3: {From: 0x66, To: 0x3b},
+ 4: {From: 0x79, To: 0x78},
+ 5: {From: 0x93, To: 0x37},
+ 6: {From: 0xa3, To: 0x133},
+ 7: {From: 0xc1, To: 0x133},
+ 8: {From: 0xd7, To: 0x13f},
+ 9: {From: 0xdc, To: 0x2b},
+ 10: {From: 0xef, To: 0x133},
+ 11: {From: 0xf2, To: 0xe2},
+ 12: {From: 0xfc, To: 0x70},
+ 13: {From: 0x103, To: 0x164},
+ 14: {From: 0x12a, To: 0x126},
+ 15: {From: 0x132, To: 0x7b},
+ 16: {From: 0x13a, To: 0x13e},
+ 17: {From: 0x141, To: 0x133},
+ 18: {From: 0x15d, To: 0x15e},
+ 19: {From: 0x163, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+ // Entry 0 - 3F
+ 0, 1, 2, 3, 5, 9, 11, 13,
+ 14, 15, 17, 18, 19, 21, 29, 30,
+ 34, 35, 39, 53, 54, 57, 61, 142,
+ 143, 145, 150, 151, 154, 155, 202, 419,
+ 958, 0, 20, 784, 4, 28, 660, 8,
+ 51, 530, 24, 10, 32, 16, 40, 36,
+ 533, 248, 31, 70, 52, 50, 56, 854,
+ 100, 48, 108, 204, 652, 60, 96, 68,
+ // Entry 40 - 7F
+ 535, 76, 44, 64, 104, 74, 72, 112,
+ 84, 124, 166, 180, 140, 178, 756, 384,
+ 184, 152, 120, 156, 170, 0, 188, 891,
+ 296, 192, 132, 531, 162, 196, 203, 278,
+ 276, 0, 262, 208, 212, 214, 204, 12,
+ 0, 218, 233, 818, 732, 232, 724, 231,
+ 967, 0, 246, 242, 238, 583, 234, 0,
+ 250, 249, 266, 826, 308, 268, 254, 831,
+ // Entry 80 - BF
+ 288, 292, 304, 270, 324, 312, 226, 300,
+ 239, 320, 316, 624, 328, 344, 334, 340,
+ 191, 332, 348, 854, 0, 360, 372, 376,
+ 833, 356, 86, 368, 364, 352, 380, 832,
+ 388, 400, 392, 581, 404, 417, 116, 296,
+ 174, 659, 408, 410, 414, 136, 398, 418,
+ 422, 662, 438, 144, 430, 426, 440, 442,
+ 428, 434, 504, 492, 498, 499, 663, 450,
+ // Entry C0 - FF
+ 584, 581, 807, 466, 104, 496, 446, 580,
+ 474, 478, 500, 470, 480, 462, 454, 484,
+ 458, 508, 516, 540, 562, 574, 566, 548,
+ 558, 528, 578, 524, 10, 520, 536, 570,
+ 554, 512, 591, 0, 604, 258, 598, 608,
+ 586, 616, 666, 612, 630, 275, 620, 581,
+ 585, 600, 591, 634, 959, 960, 961, 962,
+ 963, 964, 965, 966, 967, 968, 969, 970,
+ // Entry 100 - 13F
+ 971, 972, 638, 716, 642, 688, 643, 646,
+ 682, 90, 690, 729, 752, 702, 654, 705,
+ 744, 703, 694, 674, 686, 706, 740, 728,
+ 678, 810, 222, 534, 760, 748, 0, 796,
+ 148, 260, 768, 764, 762, 772, 626, 795,
+ 788, 776, 626, 792, 780, 798, 158, 834,
+ 804, 800, 826, 581, 0, 840, 858, 860,
+ 336, 670, 704, 862, 92, 850, 704, 548,
+ // Entry 140 - 17F
+ 876, 581, 882, 973, 974, 975, 976, 977,
+ 978, 979, 980, 981, 982, 983, 984, 985,
+ 986, 987, 988, 989, 990, 991, 992, 993,
+ 994, 995, 996, 997, 998, 720, 887, 175,
+ 891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+ 0, 59, 108, 143, 181, 220, 259, 291,
+ 333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+ // Entry 0 - 3F
+ 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+ 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+ 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+ 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+ 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+ 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+ 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+ 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+ // Entry 40 - 7F
+ 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+ 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+ 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+ 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+ 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+ 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+ 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+ 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+ // Entry 80 - BF
+ 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+ 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+ 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+ 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+ 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+ 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+ 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+ 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+ // Entry C0 - FF
+ 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+ 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+ 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+ 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+ 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+ 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+ 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+ 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+ // Entry 100 - 13F
+ 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+ 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+ 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+ 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+ 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+ 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+ 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+ 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+ // Entry 140 - 17F
+ 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+ 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+ "1606nict": 0x0,
+ "1694acad": 0x1,
+ "1901": 0x2,
+ "1959acad": 0x3,
+ "1994": 0x4d,
+ "1996": 0x4,
+ "abl1943": 0x5,
+ "akuapem": 0x6,
+ "alalc97": 0x4f,
+ "aluku": 0x7,
+ "ao1990": 0x8,
+ "arevela": 0x9,
+ "arevmda": 0xa,
+ "asante": 0xb,
+ "baku1926": 0xc,
+ "balanka": 0xd,
+ "barla": 0xe,
+ "basiceng": 0xf,
+ "bauddha": 0x10,
+ "biscayan": 0x11,
+ "biske": 0x48,
+ "bohoric": 0x12,
+ "boont": 0x13,
+ "colb1945": 0x14,
+ "cornu": 0x15,
+ "dajnko": 0x16,
+ "ekavsk": 0x17,
+ "emodeng": 0x18,
+ "fonipa": 0x50,
+ "fonnapa": 0x51,
+ "fonupa": 0x52,
+ "fonxsamp": 0x53,
+ "hepburn": 0x19,
+ "heploc": 0x4e,
+ "hognorsk": 0x1a,
+ "hsistemo": 0x1b,
+ "ijekavsk": 0x1c,
+ "itihasa": 0x1d,
+ "jauer": 0x1e,
+ "jyutping": 0x1f,
+ "kkcor": 0x20,
+ "kociewie": 0x21,
+ "kscor": 0x22,
+ "laukika": 0x23,
+ "lipaw": 0x49,
+ "luna1918": 0x24,
+ "metelko": 0x25,
+ "monoton": 0x26,
+ "ndyuka": 0x27,
+ "nedis": 0x28,
+ "newfound": 0x29,
+ "njiva": 0x4a,
+ "nulik": 0x2a,
+ "osojs": 0x4b,
+ "oxendict": 0x2b,
+ "pahawh2": 0x2c,
+ "pahawh3": 0x2d,
+ "pahawh4": 0x2e,
+ "pamaka": 0x2f,
+ "petr1708": 0x30,
+ "pinyin": 0x31,
+ "polyton": 0x32,
+ "puter": 0x33,
+ "rigik": 0x34,
+ "rozaj": 0x35,
+ "rumgr": 0x36,
+ "scotland": 0x37,
+ "scouse": 0x38,
+ "simple": 0x54,
+ "solba": 0x4c,
+ "sotav": 0x39,
+ "spanglis": 0x3a,
+ "surmiran": 0x3b,
+ "sursilv": 0x3c,
+ "sutsilv": 0x3d,
+ "tarask": 0x3e,
+ "uccor": 0x3f,
+ "ucrcor": 0x40,
+ "ulster": 0x41,
+ "unifon": 0x42,
+ "vaidika": 0x43,
+ "valencia": 0x44,
+ "vallader": 0x45,
+ "wadegile": 0x46,
+ "xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+ lang uint16
+ region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+ 1: {lang: 0x14e, region: 0x84},
+ 3: {lang: 0x2a2, region: 0x106},
+ 4: {lang: 0x1f, region: 0x99},
+ 5: {lang: 0x3a, region: 0x6b},
+ 7: {lang: 0x3b, region: 0x9c},
+ 8: {lang: 0x1d7, region: 0x28},
+ 9: {lang: 0x13, region: 0x9c},
+ 10: {lang: 0x5b, region: 0x95},
+ 11: {lang: 0x60, region: 0x52},
+ 12: {lang: 0xb9, region: 0xb4},
+ 13: {lang: 0x63, region: 0x95},
+ 14: {lang: 0xa5, region: 0x35},
+ 15: {lang: 0x3e9, region: 0x99},
+ 17: {lang: 0x529, region: 0x12e},
+ 18: {lang: 0x3b1, region: 0x99},
+ 19: {lang: 0x15e, region: 0x78},
+ 20: {lang: 0xc2, region: 0x95},
+ 21: {lang: 0x9d, region: 0xe7},
+ 22: {lang: 0xdb, region: 0x35},
+ 23: {lang: 0xf3, region: 0x49},
+ 24: {lang: 0x4f0, region: 0x12b},
+ 25: {lang: 0xe7, region: 0x13e},
+ 26: {lang: 0xe5, region: 0x135},
+ 28: {lang: 0xf1, region: 0x6b},
+ 30: {lang: 0x1a0, region: 0x5d},
+ 31: {lang: 0x3e2, region: 0x106},
+ 33: {lang: 0x1be, region: 0x99},
+ 36: {lang: 0x15e, region: 0x78},
+ 39: {lang: 0x133, region: 0x6b},
+ 40: {lang: 0x431, region: 0x27},
+ 41: {lang: 0x27, region: 0x6f},
+ 43: {lang: 0x210, region: 0x7d},
+ 44: {lang: 0xfe, region: 0x38},
+ 46: {lang: 0x19b, region: 0x99},
+ 47: {lang: 0x19e, region: 0x130},
+ 48: {lang: 0x3e9, region: 0x99},
+ 49: {lang: 0x136, region: 0x87},
+ 50: {lang: 0x1a4, region: 0x99},
+ 51: {lang: 0x39d, region: 0x99},
+ 52: {lang: 0x529, region: 0x12e},
+ 53: {lang: 0x254, region: 0xab},
+ 54: {lang: 0x529, region: 0x53},
+ 55: {lang: 0x1cb, region: 0xe7},
+ 56: {lang: 0x529, region: 0x53},
+ 57: {lang: 0x529, region: 0x12e},
+ 58: {lang: 0x2fd, region: 0x9b},
+ 59: {lang: 0x1bc, region: 0x97},
+ 60: {lang: 0x200, region: 0xa2},
+ 61: {lang: 0x1c5, region: 0x12b},
+ 62: {lang: 0x1ca, region: 0xaf},
+ 65: {lang: 0x1d5, region: 0x92},
+ 67: {lang: 0x142, region: 0x9e},
+ 68: {lang: 0x254, region: 0xab},
+ 69: {lang: 0x20e, region: 0x95},
+ 70: {lang: 0x200, region: 0xa2},
+ 72: {lang: 0x135, region: 0xc4},
+ 73: {lang: 0x200, region: 0xa2},
+ 74: {lang: 0x3bb, region: 0xe8},
+ 75: {lang: 0x24a, region: 0xa6},
+ 76: {lang: 0x3fa, region: 0x99},
+ 79: {lang: 0x251, region: 0x99},
+ 80: {lang: 0x254, region: 0xab},
+ 82: {lang: 0x88, region: 0x99},
+ 83: {lang: 0x370, region: 0x123},
+ 84: {lang: 0x2b8, region: 0xaf},
+ 89: {lang: 0x29f, region: 0x99},
+ 90: {lang: 0x2a8, region: 0x99},
+ 91: {lang: 0x28f, region: 0x87},
+ 92: {lang: 0x1a0, region: 0x87},
+ 93: {lang: 0x2ac, region: 0x53},
+ 95: {lang: 0x4f4, region: 0x12b},
+ 96: {lang: 0x4f5, region: 0x12b},
+ 97: {lang: 0x1be, region: 0x99},
+ 99: {lang: 0x337, region: 0x9c},
+ 100: {lang: 0x4f7, region: 0x53},
+ 101: {lang: 0xa9, region: 0x53},
+ 104: {lang: 0x2e8, region: 0x112},
+ 105: {lang: 0x4f8, region: 0x10b},
+ 106: {lang: 0x4f8, region: 0x10b},
+ 107: {lang: 0x304, region: 0x99},
+ 108: {lang: 0x31b, region: 0x99},
+ 109: {lang: 0x30b, region: 0x53},
+ 111: {lang: 0x31e, region: 0x35},
+ 112: {lang: 0x30e, region: 0x99},
+ 113: {lang: 0x414, region: 0xe8},
+ 114: {lang: 0x331, region: 0xc4},
+ 115: {lang: 0x4f9, region: 0x108},
+ 116: {lang: 0x3b, region: 0xa1},
+ 117: {lang: 0x353, region: 0xdb},
+ 120: {lang: 0x2d0, region: 0x84},
+ 121: {lang: 0x52a, region: 0x53},
+ 122: {lang: 0x403, region: 0x96},
+ 123: {lang: 0x3ee, region: 0x99},
+ 124: {lang: 0x39b, region: 0xc5},
+ 125: {lang: 0x395, region: 0x99},
+ 126: {lang: 0x399, region: 0x135},
+ 127: {lang: 0x429, region: 0x115},
+ 128: {lang: 0x3b, region: 0x11c},
+ 129: {lang: 0xfd, region: 0xc4},
+ 130: {lang: 0x27d, region: 0x106},
+ 131: {lang: 0x2c9, region: 0x53},
+ 132: {lang: 0x39f, region: 0x9c},
+ 133: {lang: 0x39f, region: 0x53},
+ 135: {lang: 0x3ad, region: 0xb0},
+ 137: {lang: 0x1c6, region: 0x53},
+ 138: {lang: 0x4fd, region: 0x9c},
+ 189: {lang: 0x3cb, region: 0x95},
+ 191: {lang: 0x372, region: 0x10c},
+ 192: {lang: 0x420, region: 0x97},
+ 194: {lang: 0x4ff, region: 0x15e},
+ 195: {lang: 0x3f0, region: 0x99},
+ 196: {lang: 0x45, region: 0x135},
+ 197: {lang: 0x139, region: 0x7b},
+ 198: {lang: 0x3e9, region: 0x99},
+ 200: {lang: 0x3e9, region: 0x99},
+ 201: {lang: 0x3fa, region: 0x99},
+ 202: {lang: 0x40c, region: 0xb3},
+ 203: {lang: 0x433, region: 0x99},
+ 204: {lang: 0xef, region: 0xc5},
+ 205: {lang: 0x43e, region: 0x95},
+ 206: {lang: 0x44d, region: 0x35},
+ 207: {lang: 0x44e, region: 0x9b},
+ 211: {lang: 0x45a, region: 0xe7},
+ 212: {lang: 0x11a, region: 0x99},
+ 213: {lang: 0x45e, region: 0x53},
+ 214: {lang: 0x232, region: 0x53},
+ 215: {lang: 0x450, region: 0x99},
+ 216: {lang: 0x4a5, region: 0x53},
+ 217: {lang: 0x9f, region: 0x13e},
+ 218: {lang: 0x461, region: 0x99},
+ 220: {lang: 0x528, region: 0xba},
+ 221: {lang: 0x153, region: 0xe7},
+ 222: {lang: 0x128, region: 0xcd},
+ 223: {lang: 0x46b, region: 0x123},
+ 224: {lang: 0xa9, region: 0x53},
+ 225: {lang: 0x2ce, region: 0x99},
+ 226: {lang: 0x4ad, region: 0x11c},
+ 227: {lang: 0x4be, region: 0xb4},
+ 229: {lang: 0x1ce, region: 0x99},
+ 232: {lang: 0x3a9, region: 0x9c},
+ 233: {lang: 0x22, region: 0x9b},
+ 234: {lang: 0x1ea, region: 0x53},
+ 235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+ region uint16
+ script uint8
+ flags uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+ 0: {region: 0x135, script: 0x57, flags: 0x0},
+ 1: {region: 0x6f, script: 0x57, flags: 0x0},
+ 2: {region: 0x165, script: 0x57, flags: 0x0},
+ 3: {region: 0x165, script: 0x57, flags: 0x0},
+ 4: {region: 0x165, script: 0x57, flags: 0x0},
+ 5: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 6: {region: 0x165, script: 0x57, flags: 0x0},
+ 7: {region: 0x165, script: 0x1f, flags: 0x0},
+ 8: {region: 0x80, script: 0x57, flags: 0x0},
+ 9: {region: 0x165, script: 0x57, flags: 0x0},
+ 10: {region: 0x165, script: 0x57, flags: 0x0},
+ 11: {region: 0x165, script: 0x57, flags: 0x0},
+ 12: {region: 0x95, script: 0x57, flags: 0x0},
+ 13: {region: 0x131, script: 0x57, flags: 0x0},
+ 14: {region: 0x80, script: 0x57, flags: 0x0},
+ 15: {region: 0x165, script: 0x57, flags: 0x0},
+ 16: {region: 0x165, script: 0x57, flags: 0x0},
+ 17: {region: 0x106, script: 0x1f, flags: 0x0},
+ 18: {region: 0x165, script: 0x57, flags: 0x0},
+ 19: {region: 0x9c, script: 0x9, flags: 0x0},
+ 20: {region: 0x128, script: 0x5, flags: 0x0},
+ 21: {region: 0x165, script: 0x57, flags: 0x0},
+ 22: {region: 0x161, script: 0x57, flags: 0x0},
+ 23: {region: 0x165, script: 0x57, flags: 0x0},
+ 24: {region: 0x165, script: 0x57, flags: 0x0},
+ 25: {region: 0x165, script: 0x57, flags: 0x0},
+ 26: {region: 0x165, script: 0x57, flags: 0x0},
+ 27: {region: 0x165, script: 0x57, flags: 0x0},
+ 28: {region: 0x52, script: 0x57, flags: 0x0},
+ 29: {region: 0x165, script: 0x57, flags: 0x0},
+ 30: {region: 0x165, script: 0x57, flags: 0x0},
+ 31: {region: 0x99, script: 0x4, flags: 0x0},
+ 32: {region: 0x165, script: 0x57, flags: 0x0},
+ 33: {region: 0x80, script: 0x57, flags: 0x0},
+ 34: {region: 0x9b, script: 0xe9, flags: 0x0},
+ 35: {region: 0x165, script: 0x57, flags: 0x0},
+ 36: {region: 0x165, script: 0x57, flags: 0x0},
+ 37: {region: 0x14d, script: 0x57, flags: 0x0},
+ 38: {region: 0x106, script: 0x1f, flags: 0x0},
+ 39: {region: 0x6f, script: 0x29, flags: 0x0},
+ 40: {region: 0x165, script: 0x57, flags: 0x0},
+ 41: {region: 0x165, script: 0x57, flags: 0x0},
+ 42: {region: 0xd6, script: 0x57, flags: 0x0},
+ 43: {region: 0x165, script: 0x57, flags: 0x0},
+ 45: {region: 0x165, script: 0x57, flags: 0x0},
+ 46: {region: 0x165, script: 0x57, flags: 0x0},
+ 47: {region: 0x165, script: 0x57, flags: 0x0},
+ 48: {region: 0x165, script: 0x57, flags: 0x0},
+ 49: {region: 0x165, script: 0x57, flags: 0x0},
+ 50: {region: 0x165, script: 0x57, flags: 0x0},
+ 51: {region: 0x95, script: 0x57, flags: 0x0},
+ 52: {region: 0x165, script: 0x5, flags: 0x0},
+ 53: {region: 0x122, script: 0x5, flags: 0x0},
+ 54: {region: 0x165, script: 0x57, flags: 0x0},
+ 55: {region: 0x165, script: 0x57, flags: 0x0},
+ 56: {region: 0x165, script: 0x57, flags: 0x0},
+ 57: {region: 0x165, script: 0x57, flags: 0x0},
+ 58: {region: 0x6b, script: 0x5, flags: 0x0},
+ 59: {region: 0x0, script: 0x3, flags: 0x1},
+ 60: {region: 0x165, script: 0x57, flags: 0x0},
+ 61: {region: 0x51, script: 0x57, flags: 0x0},
+ 62: {region: 0x3f, script: 0x57, flags: 0x0},
+ 63: {region: 0x67, script: 0x5, flags: 0x0},
+ 65: {region: 0xba, script: 0x5, flags: 0x0},
+ 66: {region: 0x6b, script: 0x5, flags: 0x0},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0x12f, script: 0x57, flags: 0x0},
+ 69: {region: 0x135, script: 0xc4, flags: 0x0},
+ 70: {region: 0x165, script: 0x57, flags: 0x0},
+ 71: {region: 0x165, script: 0x57, flags: 0x0},
+ 72: {region: 0x6e, script: 0x57, flags: 0x0},
+ 73: {region: 0x165, script: 0x57, flags: 0x0},
+ 74: {region: 0x165, script: 0x57, flags: 0x0},
+ 75: {region: 0x49, script: 0x57, flags: 0x0},
+ 76: {region: 0x165, script: 0x57, flags: 0x0},
+ 77: {region: 0x106, script: 0x1f, flags: 0x0},
+ 78: {region: 0x165, script: 0x5, flags: 0x0},
+ 79: {region: 0x165, script: 0x57, flags: 0x0},
+ 80: {region: 0x165, script: 0x57, flags: 0x0},
+ 81: {region: 0x165, script: 0x57, flags: 0x0},
+ 82: {region: 0x99, script: 0x21, flags: 0x0},
+ 83: {region: 0x165, script: 0x57, flags: 0x0},
+ 84: {region: 0x165, script: 0x57, flags: 0x0},
+ 85: {region: 0x165, script: 0x57, flags: 0x0},
+ 86: {region: 0x3f, script: 0x57, flags: 0x0},
+ 87: {region: 0x165, script: 0x57, flags: 0x0},
+ 88: {region: 0x3, script: 0x5, flags: 0x1},
+ 89: {region: 0x106, script: 0x1f, flags: 0x0},
+ 90: {region: 0xe8, script: 0x5, flags: 0x0},
+ 91: {region: 0x95, script: 0x57, flags: 0x0},
+ 92: {region: 0xdb, script: 0x21, flags: 0x0},
+ 93: {region: 0x2e, script: 0x57, flags: 0x0},
+ 94: {region: 0x52, script: 0x57, flags: 0x0},
+ 95: {region: 0x165, script: 0x57, flags: 0x0},
+ 96: {region: 0x52, script: 0xb, flags: 0x0},
+ 97: {region: 0x165, script: 0x57, flags: 0x0},
+ 98: {region: 0x165, script: 0x57, flags: 0x0},
+ 99: {region: 0x95, script: 0x57, flags: 0x0},
+ 100: {region: 0x165, script: 0x57, flags: 0x0},
+ 101: {region: 0x52, script: 0x57, flags: 0x0},
+ 102: {region: 0x165, script: 0x57, flags: 0x0},
+ 103: {region: 0x165, script: 0x57, flags: 0x0},
+ 104: {region: 0x165, script: 0x57, flags: 0x0},
+ 105: {region: 0x165, script: 0x57, flags: 0x0},
+ 106: {region: 0x4f, script: 0x57, flags: 0x0},
+ 107: {region: 0x165, script: 0x57, flags: 0x0},
+ 108: {region: 0x165, script: 0x57, flags: 0x0},
+ 109: {region: 0x165, script: 0x57, flags: 0x0},
+ 110: {region: 0x165, script: 0x29, flags: 0x0},
+ 111: {region: 0x165, script: 0x57, flags: 0x0},
+ 112: {region: 0x165, script: 0x57, flags: 0x0},
+ 113: {region: 0x47, script: 0x1f, flags: 0x0},
+ 114: {region: 0x165, script: 0x57, flags: 0x0},
+ 115: {region: 0x165, script: 0x57, flags: 0x0},
+ 116: {region: 0x10b, script: 0x5, flags: 0x0},
+ 117: {region: 0x162, script: 0x57, flags: 0x0},
+ 118: {region: 0x165, script: 0x57, flags: 0x0},
+ 119: {region: 0x95, script: 0x57, flags: 0x0},
+ 120: {region: 0x165, script: 0x57, flags: 0x0},
+ 121: {region: 0x12f, script: 0x57, flags: 0x0},
+ 122: {region: 0x52, script: 0x57, flags: 0x0},
+ 123: {region: 0x99, script: 0xd7, flags: 0x0},
+ 124: {region: 0xe8, script: 0x5, flags: 0x0},
+ 125: {region: 0x99, script: 0x21, flags: 0x0},
+ 126: {region: 0x38, script: 0x1f, flags: 0x0},
+ 127: {region: 0x99, script: 0x21, flags: 0x0},
+ 128: {region: 0xe8, script: 0x5, flags: 0x0},
+ 129: {region: 0x12b, script: 0x31, flags: 0x0},
+ 131: {region: 0x99, script: 0x21, flags: 0x0},
+ 132: {region: 0x165, script: 0x57, flags: 0x0},
+ 133: {region: 0x99, script: 0x21, flags: 0x0},
+ 134: {region: 0xe7, script: 0x57, flags: 0x0},
+ 135: {region: 0x165, script: 0x57, flags: 0x0},
+ 136: {region: 0x99, script: 0x21, flags: 0x0},
+ 137: {region: 0x165, script: 0x57, flags: 0x0},
+ 138: {region: 0x13f, script: 0x57, flags: 0x0},
+ 139: {region: 0x165, script: 0x57, flags: 0x0},
+ 140: {region: 0x165, script: 0x57, flags: 0x0},
+ 141: {region: 0xe7, script: 0x57, flags: 0x0},
+ 142: {region: 0x165, script: 0x57, flags: 0x0},
+ 143: {region: 0xd6, script: 0x57, flags: 0x0},
+ 144: {region: 0x165, script: 0x57, flags: 0x0},
+ 145: {region: 0x165, script: 0x57, flags: 0x0},
+ 146: {region: 0x165, script: 0x57, flags: 0x0},
+ 147: {region: 0x165, script: 0x29, flags: 0x0},
+ 148: {region: 0x99, script: 0x21, flags: 0x0},
+ 149: {region: 0x95, script: 0x57, flags: 0x0},
+ 150: {region: 0x165, script: 0x57, flags: 0x0},
+ 151: {region: 0x165, script: 0x57, flags: 0x0},
+ 152: {region: 0x114, script: 0x57, flags: 0x0},
+ 153: {region: 0x165, script: 0x57, flags: 0x0},
+ 154: {region: 0x165, script: 0x57, flags: 0x0},
+ 155: {region: 0x52, script: 0x57, flags: 0x0},
+ 156: {region: 0x165, script: 0x57, flags: 0x0},
+ 157: {region: 0xe7, script: 0x57, flags: 0x0},
+ 158: {region: 0x165, script: 0x57, flags: 0x0},
+ 159: {region: 0x13e, script: 0xd9, flags: 0x0},
+ 160: {region: 0xc3, script: 0x57, flags: 0x0},
+ 161: {region: 0x165, script: 0x57, flags: 0x0},
+ 162: {region: 0x165, script: 0x57, flags: 0x0},
+ 163: {region: 0xc3, script: 0x57, flags: 0x0},
+ 164: {region: 0x165, script: 0x57, flags: 0x0},
+ 165: {region: 0x35, script: 0xe, flags: 0x0},
+ 166: {region: 0x165, script: 0x57, flags: 0x0},
+ 167: {region: 0x165, script: 0x57, flags: 0x0},
+ 168: {region: 0x165, script: 0x57, flags: 0x0},
+ 169: {region: 0x53, script: 0xe0, flags: 0x0},
+ 170: {region: 0x165, script: 0x57, flags: 0x0},
+ 171: {region: 0x165, script: 0x57, flags: 0x0},
+ 172: {region: 0x165, script: 0x57, flags: 0x0},
+ 173: {region: 0x99, script: 0xe, flags: 0x0},
+ 174: {region: 0x165, script: 0x57, flags: 0x0},
+ 175: {region: 0x9c, script: 0x5, flags: 0x0},
+ 176: {region: 0x165, script: 0x57, flags: 0x0},
+ 177: {region: 0x4f, script: 0x57, flags: 0x0},
+ 178: {region: 0x78, script: 0x57, flags: 0x0},
+ 179: {region: 0x99, script: 0x21, flags: 0x0},
+ 180: {region: 0xe8, script: 0x5, flags: 0x0},
+ 181: {region: 0x99, script: 0x21, flags: 0x0},
+ 182: {region: 0x165, script: 0x57, flags: 0x0},
+ 183: {region: 0x33, script: 0x57, flags: 0x0},
+ 184: {region: 0x165, script: 0x57, flags: 0x0},
+ 185: {region: 0xb4, script: 0xc, flags: 0x0},
+ 186: {region: 0x52, script: 0x57, flags: 0x0},
+ 187: {region: 0x165, script: 0x29, flags: 0x0},
+ 188: {region: 0xe7, script: 0x57, flags: 0x0},
+ 189: {region: 0x165, script: 0x57, flags: 0x0},
+ 190: {region: 0xe8, script: 0x21, flags: 0x0},
+ 191: {region: 0x106, script: 0x1f, flags: 0x0},
+ 192: {region: 0x15f, script: 0x57, flags: 0x0},
+ 193: {region: 0x165, script: 0x57, flags: 0x0},
+ 194: {region: 0x95, script: 0x57, flags: 0x0},
+ 195: {region: 0x165, script: 0x57, flags: 0x0},
+ 196: {region: 0x52, script: 0x57, flags: 0x0},
+ 197: {region: 0x165, script: 0x57, flags: 0x0},
+ 198: {region: 0x165, script: 0x57, flags: 0x0},
+ 199: {region: 0x165, script: 0x57, flags: 0x0},
+ 200: {region: 0x86, script: 0x57, flags: 0x0},
+ 201: {region: 0x165, script: 0x57, flags: 0x0},
+ 202: {region: 0x165, script: 0x57, flags: 0x0},
+ 203: {region: 0x165, script: 0x57, flags: 0x0},
+ 204: {region: 0x165, script: 0x57, flags: 0x0},
+ 205: {region: 0x6d, script: 0x29, flags: 0x0},
+ 206: {region: 0x165, script: 0x57, flags: 0x0},
+ 207: {region: 0x165, script: 0x57, flags: 0x0},
+ 208: {region: 0x52, script: 0x57, flags: 0x0},
+ 209: {region: 0x165, script: 0x57, flags: 0x0},
+ 210: {region: 0x165, script: 0x57, flags: 0x0},
+ 211: {region: 0xc3, script: 0x57, flags: 0x0},
+ 212: {region: 0x165, script: 0x57, flags: 0x0},
+ 213: {region: 0x165, script: 0x57, flags: 0x0},
+ 214: {region: 0x165, script: 0x57, flags: 0x0},
+ 215: {region: 0x6e, script: 0x57, flags: 0x0},
+ 216: {region: 0x165, script: 0x57, flags: 0x0},
+ 217: {region: 0x165, script: 0x57, flags: 0x0},
+ 218: {region: 0xd6, script: 0x57, flags: 0x0},
+ 219: {region: 0x35, script: 0x16, flags: 0x0},
+ 220: {region: 0x106, script: 0x1f, flags: 0x0},
+ 221: {region: 0xe7, script: 0x57, flags: 0x0},
+ 222: {region: 0x165, script: 0x57, flags: 0x0},
+ 223: {region: 0x131, script: 0x57, flags: 0x0},
+ 224: {region: 0x8a, script: 0x57, flags: 0x0},
+ 225: {region: 0x75, script: 0x57, flags: 0x0},
+ 226: {region: 0x106, script: 0x1f, flags: 0x0},
+ 227: {region: 0x135, script: 0x57, flags: 0x0},
+ 228: {region: 0x49, script: 0x57, flags: 0x0},
+ 229: {region: 0x135, script: 0x1a, flags: 0x0},
+ 230: {region: 0xa6, script: 0x5, flags: 0x0},
+ 231: {region: 0x13e, script: 0x19, flags: 0x0},
+ 232: {region: 0x165, script: 0x57, flags: 0x0},
+ 233: {region: 0x9b, script: 0x5, flags: 0x0},
+ 234: {region: 0x165, script: 0x57, flags: 0x0},
+ 235: {region: 0x165, script: 0x57, flags: 0x0},
+ 236: {region: 0x165, script: 0x57, flags: 0x0},
+ 237: {region: 0x165, script: 0x57, flags: 0x0},
+ 238: {region: 0x165, script: 0x57, flags: 0x0},
+ 239: {region: 0xc5, script: 0xcc, flags: 0x0},
+ 240: {region: 0x78, script: 0x57, flags: 0x0},
+ 241: {region: 0x6b, script: 0x1c, flags: 0x0},
+ 242: {region: 0xe7, script: 0x57, flags: 0x0},
+ 243: {region: 0x49, script: 0x17, flags: 0x0},
+ 244: {region: 0x130, script: 0x1f, flags: 0x0},
+ 245: {region: 0x49, script: 0x17, flags: 0x0},
+ 246: {region: 0x49, script: 0x17, flags: 0x0},
+ 247: {region: 0x49, script: 0x17, flags: 0x0},
+ 248: {region: 0x49, script: 0x17, flags: 0x0},
+ 249: {region: 0x10a, script: 0x57, flags: 0x0},
+ 250: {region: 0x5e, script: 0x57, flags: 0x0},
+ 251: {region: 0xe9, script: 0x57, flags: 0x0},
+ 252: {region: 0x49, script: 0x17, flags: 0x0},
+ 253: {region: 0xc4, script: 0x81, flags: 0x0},
+ 254: {region: 0x8, script: 0x2, flags: 0x1},
+ 255: {region: 0x106, script: 0x1f, flags: 0x0},
+ 256: {region: 0x7b, script: 0x57, flags: 0x0},
+ 257: {region: 0x63, script: 0x57, flags: 0x0},
+ 258: {region: 0x165, script: 0x57, flags: 0x0},
+ 259: {region: 0x165, script: 0x57, flags: 0x0},
+ 260: {region: 0x165, script: 0x57, flags: 0x0},
+ 261: {region: 0x165, script: 0x57, flags: 0x0},
+ 262: {region: 0x135, script: 0x57, flags: 0x0},
+ 263: {region: 0x106, script: 0x1f, flags: 0x0},
+ 264: {region: 0xa4, script: 0x57, flags: 0x0},
+ 265: {region: 0x165, script: 0x57, flags: 0x0},
+ 266: {region: 0x165, script: 0x57, flags: 0x0},
+ 267: {region: 0x99, script: 0x5, flags: 0x0},
+ 268: {region: 0x165, script: 0x57, flags: 0x0},
+ 269: {region: 0x60, script: 0x57, flags: 0x0},
+ 270: {region: 0x165, script: 0x57, flags: 0x0},
+ 271: {region: 0x49, script: 0x57, flags: 0x0},
+ 272: {region: 0x165, script: 0x57, flags: 0x0},
+ 273: {region: 0x165, script: 0x57, flags: 0x0},
+ 274: {region: 0x165, script: 0x57, flags: 0x0},
+ 275: {region: 0x165, script: 0x5, flags: 0x0},
+ 276: {region: 0x49, script: 0x57, flags: 0x0},
+ 277: {region: 0x165, script: 0x57, flags: 0x0},
+ 278: {region: 0x165, script: 0x57, flags: 0x0},
+ 279: {region: 0xd4, script: 0x57, flags: 0x0},
+ 280: {region: 0x4f, script: 0x57, flags: 0x0},
+ 281: {region: 0x165, script: 0x57, flags: 0x0},
+ 282: {region: 0x99, script: 0x5, flags: 0x0},
+ 283: {region: 0x165, script: 0x57, flags: 0x0},
+ 284: {region: 0x165, script: 0x57, flags: 0x0},
+ 285: {region: 0x165, script: 0x57, flags: 0x0},
+ 286: {region: 0x165, script: 0x29, flags: 0x0},
+ 287: {region: 0x60, script: 0x57, flags: 0x0},
+ 288: {region: 0xc3, script: 0x57, flags: 0x0},
+ 289: {region: 0xd0, script: 0x57, flags: 0x0},
+ 290: {region: 0x165, script: 0x57, flags: 0x0},
+ 291: {region: 0xdb, script: 0x21, flags: 0x0},
+ 292: {region: 0x52, script: 0x57, flags: 0x0},
+ 293: {region: 0x165, script: 0x57, flags: 0x0},
+ 294: {region: 0x165, script: 0x57, flags: 0x0},
+ 295: {region: 0x165, script: 0x57, flags: 0x0},
+ 296: {region: 0xcd, script: 0xde, flags: 0x0},
+ 297: {region: 0x165, script: 0x57, flags: 0x0},
+ 298: {region: 0x165, script: 0x57, flags: 0x0},
+ 299: {region: 0x114, script: 0x57, flags: 0x0},
+ 300: {region: 0x37, script: 0x57, flags: 0x0},
+ 301: {region: 0x43, script: 0xe0, flags: 0x0},
+ 302: {region: 0x165, script: 0x57, flags: 0x0},
+ 303: {region: 0xa4, script: 0x57, flags: 0x0},
+ 304: {region: 0x80, script: 0x57, flags: 0x0},
+ 305: {region: 0xd6, script: 0x57, flags: 0x0},
+ 306: {region: 0x9e, script: 0x57, flags: 0x0},
+ 307: {region: 0x6b, script: 0x27, flags: 0x0},
+ 308: {region: 0x165, script: 0x57, flags: 0x0},
+ 309: {region: 0xc4, script: 0x48, flags: 0x0},
+ 310: {region: 0x87, script: 0x31, flags: 0x0},
+ 311: {region: 0x165, script: 0x57, flags: 0x0},
+ 312: {region: 0x165, script: 0x57, flags: 0x0},
+ 313: {region: 0xa, script: 0x2, flags: 0x1},
+ 314: {region: 0x165, script: 0x57, flags: 0x0},
+ 315: {region: 0x165, script: 0x57, flags: 0x0},
+ 316: {region: 0x1, script: 0x57, flags: 0x0},
+ 317: {region: 0x165, script: 0x57, flags: 0x0},
+ 318: {region: 0x6e, script: 0x57, flags: 0x0},
+ 319: {region: 0x135, script: 0x57, flags: 0x0},
+ 320: {region: 0x6a, script: 0x57, flags: 0x0},
+ 321: {region: 0x165, script: 0x57, flags: 0x0},
+ 322: {region: 0x9e, script: 0x43, flags: 0x0},
+ 323: {region: 0x165, script: 0x57, flags: 0x0},
+ 324: {region: 0x165, script: 0x57, flags: 0x0},
+ 325: {region: 0x6e, script: 0x57, flags: 0x0},
+ 326: {region: 0x52, script: 0x57, flags: 0x0},
+ 327: {region: 0x6e, script: 0x57, flags: 0x0},
+ 328: {region: 0x9c, script: 0x5, flags: 0x0},
+ 329: {region: 0x165, script: 0x57, flags: 0x0},
+ 330: {region: 0x165, script: 0x57, flags: 0x0},
+ 331: {region: 0x165, script: 0x57, flags: 0x0},
+ 332: {region: 0x165, script: 0x57, flags: 0x0},
+ 333: {region: 0x86, script: 0x57, flags: 0x0},
+ 334: {region: 0xc, script: 0x2, flags: 0x1},
+ 335: {region: 0x165, script: 0x57, flags: 0x0},
+ 336: {region: 0xc3, script: 0x57, flags: 0x0},
+ 337: {region: 0x72, script: 0x57, flags: 0x0},
+ 338: {region: 0x10b, script: 0x5, flags: 0x0},
+ 339: {region: 0xe7, script: 0x57, flags: 0x0},
+ 340: {region: 0x10c, script: 0x57, flags: 0x0},
+ 341: {region: 0x73, script: 0x57, flags: 0x0},
+ 342: {region: 0x165, script: 0x57, flags: 0x0},
+ 343: {region: 0x165, script: 0x57, flags: 0x0},
+ 344: {region: 0x76, script: 0x57, flags: 0x0},
+ 345: {region: 0x165, script: 0x57, flags: 0x0},
+ 346: {region: 0x3b, script: 0x57, flags: 0x0},
+ 347: {region: 0x165, script: 0x57, flags: 0x0},
+ 348: {region: 0x165, script: 0x57, flags: 0x0},
+ 349: {region: 0x165, script: 0x57, flags: 0x0},
+ 350: {region: 0x78, script: 0x57, flags: 0x0},
+ 351: {region: 0x135, script: 0x57, flags: 0x0},
+ 352: {region: 0x78, script: 0x57, flags: 0x0},
+ 353: {region: 0x60, script: 0x57, flags: 0x0},
+ 354: {region: 0x60, script: 0x57, flags: 0x0},
+ 355: {region: 0x52, script: 0x5, flags: 0x0},
+ 356: {region: 0x140, script: 0x57, flags: 0x0},
+ 357: {region: 0x165, script: 0x57, flags: 0x0},
+ 358: {region: 0x84, script: 0x57, flags: 0x0},
+ 359: {region: 0x165, script: 0x57, flags: 0x0},
+ 360: {region: 0xd4, script: 0x57, flags: 0x0},
+ 361: {region: 0x9e, script: 0x57, flags: 0x0},
+ 362: {region: 0xd6, script: 0x57, flags: 0x0},
+ 363: {region: 0x165, script: 0x57, flags: 0x0},
+ 364: {region: 0x10b, script: 0x57, flags: 0x0},
+ 365: {region: 0xd9, script: 0x57, flags: 0x0},
+ 366: {region: 0x96, script: 0x57, flags: 0x0},
+ 367: {region: 0x80, script: 0x57, flags: 0x0},
+ 368: {region: 0x165, script: 0x57, flags: 0x0},
+ 369: {region: 0xbc, script: 0x57, flags: 0x0},
+ 370: {region: 0x165, script: 0x57, flags: 0x0},
+ 371: {region: 0x165, script: 0x57, flags: 0x0},
+ 372: {region: 0x165, script: 0x57, flags: 0x0},
+ 373: {region: 0x53, script: 0x38, flags: 0x0},
+ 374: {region: 0x165, script: 0x57, flags: 0x0},
+ 375: {region: 0x95, script: 0x57, flags: 0x0},
+ 376: {region: 0x165, script: 0x57, flags: 0x0},
+ 377: {region: 0x165, script: 0x57, flags: 0x0},
+ 378: {region: 0x99, script: 0x21, flags: 0x0},
+ 379: {region: 0x165, script: 0x57, flags: 0x0},
+ 380: {region: 0x9c, script: 0x5, flags: 0x0},
+ 381: {region: 0x7e, script: 0x57, flags: 0x0},
+ 382: {region: 0x7b, script: 0x57, flags: 0x0},
+ 383: {region: 0x165, script: 0x57, flags: 0x0},
+ 384: {region: 0x165, script: 0x57, flags: 0x0},
+ 385: {region: 0x165, script: 0x57, flags: 0x0},
+ 386: {region: 0x165, script: 0x57, flags: 0x0},
+ 387: {region: 0x165, script: 0x57, flags: 0x0},
+ 388: {region: 0x165, script: 0x57, flags: 0x0},
+ 389: {region: 0x6f, script: 0x29, flags: 0x0},
+ 390: {region: 0x165, script: 0x57, flags: 0x0},
+ 391: {region: 0xdb, script: 0x21, flags: 0x0},
+ 392: {region: 0x165, script: 0x57, flags: 0x0},
+ 393: {region: 0xa7, script: 0x57, flags: 0x0},
+ 394: {region: 0x165, script: 0x57, flags: 0x0},
+ 395: {region: 0xe8, script: 0x5, flags: 0x0},
+ 396: {region: 0x165, script: 0x57, flags: 0x0},
+ 397: {region: 0xe8, script: 0x5, flags: 0x0},
+ 398: {region: 0x165, script: 0x57, flags: 0x0},
+ 399: {region: 0x165, script: 0x57, flags: 0x0},
+ 400: {region: 0x6e, script: 0x57, flags: 0x0},
+ 401: {region: 0x9c, script: 0x5, flags: 0x0},
+ 402: {region: 0x165, script: 0x57, flags: 0x0},
+ 403: {region: 0x165, script: 0x29, flags: 0x0},
+ 404: {region: 0xf1, script: 0x57, flags: 0x0},
+ 405: {region: 0x165, script: 0x57, flags: 0x0},
+ 406: {region: 0x165, script: 0x57, flags: 0x0},
+ 407: {region: 0x165, script: 0x57, flags: 0x0},
+ 408: {region: 0x165, script: 0x29, flags: 0x0},
+ 409: {region: 0x165, script: 0x57, flags: 0x0},
+ 410: {region: 0x99, script: 0x21, flags: 0x0},
+ 411: {region: 0x99, script: 0xda, flags: 0x0},
+ 412: {region: 0x95, script: 0x57, flags: 0x0},
+ 413: {region: 0xd9, script: 0x57, flags: 0x0},
+ 414: {region: 0x130, script: 0x2f, flags: 0x0},
+ 415: {region: 0x165, script: 0x57, flags: 0x0},
+ 416: {region: 0xe, script: 0x2, flags: 0x1},
+ 417: {region: 0x99, script: 0xe, flags: 0x0},
+ 418: {region: 0x165, script: 0x57, flags: 0x0},
+ 419: {region: 0x4e, script: 0x57, flags: 0x0},
+ 420: {region: 0x99, script: 0x32, flags: 0x0},
+ 421: {region: 0x41, script: 0x57, flags: 0x0},
+ 422: {region: 0x54, script: 0x57, flags: 0x0},
+ 423: {region: 0x165, script: 0x57, flags: 0x0},
+ 424: {region: 0x80, script: 0x57, flags: 0x0},
+ 425: {region: 0x165, script: 0x57, flags: 0x0},
+ 426: {region: 0x165, script: 0x57, flags: 0x0},
+ 427: {region: 0xa4, script: 0x57, flags: 0x0},
+ 428: {region: 0x98, script: 0x57, flags: 0x0},
+ 429: {region: 0x165, script: 0x57, flags: 0x0},
+ 430: {region: 0xdb, script: 0x21, flags: 0x0},
+ 431: {region: 0x165, script: 0x57, flags: 0x0},
+ 432: {region: 0x165, script: 0x5, flags: 0x0},
+ 433: {region: 0x49, script: 0x57, flags: 0x0},
+ 434: {region: 0x165, script: 0x5, flags: 0x0},
+ 435: {region: 0x165, script: 0x57, flags: 0x0},
+ 436: {region: 0x10, script: 0x3, flags: 0x1},
+ 437: {region: 0x165, script: 0x57, flags: 0x0},
+ 438: {region: 0x53, script: 0x38, flags: 0x0},
+ 439: {region: 0x165, script: 0x57, flags: 0x0},
+ 440: {region: 0x135, script: 0x57, flags: 0x0},
+ 441: {region: 0x24, script: 0x5, flags: 0x0},
+ 442: {region: 0x165, script: 0x57, flags: 0x0},
+ 443: {region: 0x165, script: 0x29, flags: 0x0},
+ 444: {region: 0x97, script: 0x3b, flags: 0x0},
+ 445: {region: 0x165, script: 0x57, flags: 0x0},
+ 446: {region: 0x99, script: 0x21, flags: 0x0},
+ 447: {region: 0x165, script: 0x57, flags: 0x0},
+ 448: {region: 0x73, script: 0x57, flags: 0x0},
+ 449: {region: 0x165, script: 0x57, flags: 0x0},
+ 450: {region: 0x165, script: 0x57, flags: 0x0},
+ 451: {region: 0xe7, script: 0x57, flags: 0x0},
+ 452: {region: 0x165, script: 0x57, flags: 0x0},
+ 453: {region: 0x12b, script: 0x3d, flags: 0x0},
+ 454: {region: 0x53, script: 0x89, flags: 0x0},
+ 455: {region: 0x165, script: 0x57, flags: 0x0},
+ 456: {region: 0xe8, script: 0x5, flags: 0x0},
+ 457: {region: 0x99, script: 0x21, flags: 0x0},
+ 458: {region: 0xaf, script: 0x3e, flags: 0x0},
+ 459: {region: 0xe7, script: 0x57, flags: 0x0},
+ 460: {region: 0xe8, script: 0x5, flags: 0x0},
+ 461: {region: 0xe6, script: 0x57, flags: 0x0},
+ 462: {region: 0x99, script: 0x21, flags: 0x0},
+ 463: {region: 0x99, script: 0x21, flags: 0x0},
+ 464: {region: 0x165, script: 0x57, flags: 0x0},
+ 465: {region: 0x90, script: 0x57, flags: 0x0},
+ 466: {region: 0x60, script: 0x57, flags: 0x0},
+ 467: {region: 0x53, script: 0x38, flags: 0x0},
+ 468: {region: 0x91, script: 0x57, flags: 0x0},
+ 469: {region: 0x92, script: 0x57, flags: 0x0},
+ 470: {region: 0x165, script: 0x57, flags: 0x0},
+ 471: {region: 0x28, script: 0x8, flags: 0x0},
+ 472: {region: 0xd2, script: 0x57, flags: 0x0},
+ 473: {region: 0x78, script: 0x57, flags: 0x0},
+ 474: {region: 0x165, script: 0x57, flags: 0x0},
+ 475: {region: 0x165, script: 0x57, flags: 0x0},
+ 476: {region: 0xd0, script: 0x57, flags: 0x0},
+ 477: {region: 0xd6, script: 0x57, flags: 0x0},
+ 478: {region: 0x165, script: 0x57, flags: 0x0},
+ 479: {region: 0x165, script: 0x57, flags: 0x0},
+ 480: {region: 0x165, script: 0x57, flags: 0x0},
+ 481: {region: 0x95, script: 0x57, flags: 0x0},
+ 482: {region: 0x165, script: 0x57, flags: 0x0},
+ 483: {region: 0x165, script: 0x57, flags: 0x0},
+ 484: {region: 0x165, script: 0x57, flags: 0x0},
+ 486: {region: 0x122, script: 0x57, flags: 0x0},
+ 487: {region: 0xd6, script: 0x57, flags: 0x0},
+ 488: {region: 0x165, script: 0x57, flags: 0x0},
+ 489: {region: 0x165, script: 0x57, flags: 0x0},
+ 490: {region: 0x53, script: 0xea, flags: 0x0},
+ 491: {region: 0x165, script: 0x57, flags: 0x0},
+ 492: {region: 0x135, script: 0x57, flags: 0x0},
+ 493: {region: 0x165, script: 0x57, flags: 0x0},
+ 494: {region: 0x49, script: 0x57, flags: 0x0},
+ 495: {region: 0x165, script: 0x57, flags: 0x0},
+ 496: {region: 0x165, script: 0x57, flags: 0x0},
+ 497: {region: 0xe7, script: 0x57, flags: 0x0},
+ 498: {region: 0x165, script: 0x57, flags: 0x0},
+ 499: {region: 0x95, script: 0x57, flags: 0x0},
+ 500: {region: 0x106, script: 0x1f, flags: 0x0},
+ 501: {region: 0x1, script: 0x57, flags: 0x0},
+ 502: {region: 0x165, script: 0x57, flags: 0x0},
+ 503: {region: 0x165, script: 0x57, flags: 0x0},
+ 504: {region: 0x9d, script: 0x57, flags: 0x0},
+ 505: {region: 0x9e, script: 0x57, flags: 0x0},
+ 506: {region: 0x49, script: 0x17, flags: 0x0},
+ 507: {region: 0x97, script: 0x3b, flags: 0x0},
+ 508: {region: 0x165, script: 0x57, flags: 0x0},
+ 509: {region: 0x165, script: 0x57, flags: 0x0},
+ 510: {region: 0x106, script: 0x57, flags: 0x0},
+ 511: {region: 0x165, script: 0x57, flags: 0x0},
+ 512: {region: 0xa2, script: 0x46, flags: 0x0},
+ 513: {region: 0x165, script: 0x57, flags: 0x0},
+ 514: {region: 0xa0, script: 0x57, flags: 0x0},
+ 515: {region: 0x1, script: 0x57, flags: 0x0},
+ 516: {region: 0x165, script: 0x57, flags: 0x0},
+ 517: {region: 0x165, script: 0x57, flags: 0x0},
+ 518: {region: 0x165, script: 0x57, flags: 0x0},
+ 519: {region: 0x52, script: 0x57, flags: 0x0},
+ 520: {region: 0x130, script: 0x3b, flags: 0x0},
+ 521: {region: 0x165, script: 0x57, flags: 0x0},
+ 522: {region: 0x12f, script: 0x57, flags: 0x0},
+ 523: {region: 0xdb, script: 0x21, flags: 0x0},
+ 524: {region: 0x165, script: 0x57, flags: 0x0},
+ 525: {region: 0x63, script: 0x57, flags: 0x0},
+ 526: {region: 0x95, script: 0x57, flags: 0x0},
+ 527: {region: 0x95, script: 0x57, flags: 0x0},
+ 528: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 529: {region: 0x137, script: 0x1f, flags: 0x0},
+ 530: {region: 0x67, script: 0x57, flags: 0x0},
+ 531: {region: 0xc4, script: 0x57, flags: 0x0},
+ 532: {region: 0x165, script: 0x57, flags: 0x0},
+ 533: {region: 0x165, script: 0x57, flags: 0x0},
+ 534: {region: 0xd6, script: 0x57, flags: 0x0},
+ 535: {region: 0xa4, script: 0x57, flags: 0x0},
+ 536: {region: 0xc3, script: 0x57, flags: 0x0},
+ 537: {region: 0x106, script: 0x1f, flags: 0x0},
+ 538: {region: 0x165, script: 0x57, flags: 0x0},
+ 539: {region: 0x165, script: 0x57, flags: 0x0},
+ 540: {region: 0x165, script: 0x57, flags: 0x0},
+ 541: {region: 0x165, script: 0x57, flags: 0x0},
+ 542: {region: 0xd4, script: 0x5, flags: 0x0},
+ 543: {region: 0xd6, script: 0x57, flags: 0x0},
+ 544: {region: 0x164, script: 0x57, flags: 0x0},
+ 545: {region: 0x165, script: 0x57, flags: 0x0},
+ 546: {region: 0x165, script: 0x57, flags: 0x0},
+ 547: {region: 0x12f, script: 0x57, flags: 0x0},
+ 548: {region: 0x122, script: 0x5, flags: 0x0},
+ 549: {region: 0x165, script: 0x57, flags: 0x0},
+ 550: {region: 0x123, script: 0xdf, flags: 0x0},
+ 551: {region: 0x5a, script: 0x57, flags: 0x0},
+ 552: {region: 0x52, script: 0x57, flags: 0x0},
+ 553: {region: 0x165, script: 0x57, flags: 0x0},
+ 554: {region: 0x4f, script: 0x57, flags: 0x0},
+ 555: {region: 0x99, script: 0x21, flags: 0x0},
+ 556: {region: 0x99, script: 0x21, flags: 0x0},
+ 557: {region: 0x4b, script: 0x57, flags: 0x0},
+ 558: {region: 0x95, script: 0x57, flags: 0x0},
+ 559: {region: 0x165, script: 0x57, flags: 0x0},
+ 560: {region: 0x41, script: 0x57, flags: 0x0},
+ 561: {region: 0x99, script: 0x57, flags: 0x0},
+ 562: {region: 0x53, script: 0xd6, flags: 0x0},
+ 563: {region: 0x99, script: 0x21, flags: 0x0},
+ 564: {region: 0xc3, script: 0x57, flags: 0x0},
+ 565: {region: 0x165, script: 0x57, flags: 0x0},
+ 566: {region: 0x99, script: 0x72, flags: 0x0},
+ 567: {region: 0xe8, script: 0x5, flags: 0x0},
+ 568: {region: 0x165, script: 0x57, flags: 0x0},
+ 569: {region: 0xa4, script: 0x57, flags: 0x0},
+ 570: {region: 0x165, script: 0x57, flags: 0x0},
+ 571: {region: 0x12b, script: 0x57, flags: 0x0},
+ 572: {region: 0x165, script: 0x57, flags: 0x0},
+ 573: {region: 0xd2, script: 0x57, flags: 0x0},
+ 574: {region: 0x165, script: 0x57, flags: 0x0},
+ 575: {region: 0xaf, script: 0x54, flags: 0x0},
+ 576: {region: 0x165, script: 0x57, flags: 0x0},
+ 577: {region: 0x165, script: 0x57, flags: 0x0},
+ 578: {region: 0x13, script: 0x6, flags: 0x1},
+ 579: {region: 0x165, script: 0x57, flags: 0x0},
+ 580: {region: 0x52, script: 0x57, flags: 0x0},
+ 581: {region: 0x82, script: 0x57, flags: 0x0},
+ 582: {region: 0xa4, script: 0x57, flags: 0x0},
+ 583: {region: 0x165, script: 0x57, flags: 0x0},
+ 584: {region: 0x165, script: 0x57, flags: 0x0},
+ 585: {region: 0x165, script: 0x57, flags: 0x0},
+ 586: {region: 0xa6, script: 0x4b, flags: 0x0},
+ 587: {region: 0x2a, script: 0x57, flags: 0x0},
+ 588: {region: 0x165, script: 0x57, flags: 0x0},
+ 589: {region: 0x165, script: 0x57, flags: 0x0},
+ 590: {region: 0x165, script: 0x57, flags: 0x0},
+ 591: {region: 0x165, script: 0x57, flags: 0x0},
+ 592: {region: 0x165, script: 0x57, flags: 0x0},
+ 593: {region: 0x99, script: 0x4f, flags: 0x0},
+ 594: {region: 0x8b, script: 0x57, flags: 0x0},
+ 595: {region: 0x165, script: 0x57, flags: 0x0},
+ 596: {region: 0xab, script: 0x50, flags: 0x0},
+ 597: {region: 0x106, script: 0x1f, flags: 0x0},
+ 598: {region: 0x99, script: 0x21, flags: 0x0},
+ 599: {region: 0x165, script: 0x57, flags: 0x0},
+ 600: {region: 0x75, script: 0x57, flags: 0x0},
+ 601: {region: 0x165, script: 0x57, flags: 0x0},
+ 602: {region: 0xb4, script: 0x57, flags: 0x0},
+ 603: {region: 0x165, script: 0x57, flags: 0x0},
+ 604: {region: 0x165, script: 0x57, flags: 0x0},
+ 605: {region: 0x165, script: 0x57, flags: 0x0},
+ 606: {region: 0x165, script: 0x57, flags: 0x0},
+ 607: {region: 0x165, script: 0x57, flags: 0x0},
+ 608: {region: 0x165, script: 0x57, flags: 0x0},
+ 609: {region: 0x165, script: 0x57, flags: 0x0},
+ 610: {region: 0x165, script: 0x29, flags: 0x0},
+ 611: {region: 0x165, script: 0x57, flags: 0x0},
+ 612: {region: 0x106, script: 0x1f, flags: 0x0},
+ 613: {region: 0x112, script: 0x57, flags: 0x0},
+ 614: {region: 0xe7, script: 0x57, flags: 0x0},
+ 615: {region: 0x106, script: 0x57, flags: 0x0},
+ 616: {region: 0x165, script: 0x57, flags: 0x0},
+ 617: {region: 0x99, script: 0x21, flags: 0x0},
+ 618: {region: 0x99, script: 0x5, flags: 0x0},
+ 619: {region: 0x12f, script: 0x57, flags: 0x0},
+ 620: {region: 0x165, script: 0x57, flags: 0x0},
+ 621: {region: 0x52, script: 0x57, flags: 0x0},
+ 622: {region: 0x60, script: 0x57, flags: 0x0},
+ 623: {region: 0x165, script: 0x57, flags: 0x0},
+ 624: {region: 0x165, script: 0x57, flags: 0x0},
+ 625: {region: 0x165, script: 0x29, flags: 0x0},
+ 626: {region: 0x165, script: 0x57, flags: 0x0},
+ 627: {region: 0x165, script: 0x57, flags: 0x0},
+ 628: {region: 0x19, script: 0x3, flags: 0x1},
+ 629: {region: 0x165, script: 0x57, flags: 0x0},
+ 630: {region: 0x165, script: 0x57, flags: 0x0},
+ 631: {region: 0x165, script: 0x57, flags: 0x0},
+ 632: {region: 0x165, script: 0x57, flags: 0x0},
+ 633: {region: 0x106, script: 0x1f, flags: 0x0},
+ 634: {region: 0x165, script: 0x57, flags: 0x0},
+ 635: {region: 0x165, script: 0x57, flags: 0x0},
+ 636: {region: 0x165, script: 0x57, flags: 0x0},
+ 637: {region: 0x106, script: 0x1f, flags: 0x0},
+ 638: {region: 0x165, script: 0x57, flags: 0x0},
+ 639: {region: 0x95, script: 0x57, flags: 0x0},
+ 640: {region: 0xe8, script: 0x5, flags: 0x0},
+ 641: {region: 0x7b, script: 0x57, flags: 0x0},
+ 642: {region: 0x165, script: 0x57, flags: 0x0},
+ 643: {region: 0x165, script: 0x57, flags: 0x0},
+ 644: {region: 0x165, script: 0x57, flags: 0x0},
+ 645: {region: 0x165, script: 0x29, flags: 0x0},
+ 646: {region: 0x123, script: 0xdf, flags: 0x0},
+ 647: {region: 0xe8, script: 0x5, flags: 0x0},
+ 648: {region: 0x165, script: 0x57, flags: 0x0},
+ 649: {region: 0x165, script: 0x57, flags: 0x0},
+ 650: {region: 0x1c, script: 0x5, flags: 0x1},
+ 651: {region: 0x165, script: 0x57, flags: 0x0},
+ 652: {region: 0x165, script: 0x57, flags: 0x0},
+ 653: {region: 0x165, script: 0x57, flags: 0x0},
+ 654: {region: 0x138, script: 0x57, flags: 0x0},
+ 655: {region: 0x87, script: 0x5b, flags: 0x0},
+ 656: {region: 0x97, script: 0x3b, flags: 0x0},
+ 657: {region: 0x12f, script: 0x57, flags: 0x0},
+ 658: {region: 0xe8, script: 0x5, flags: 0x0},
+ 659: {region: 0x131, script: 0x57, flags: 0x0},
+ 660: {region: 0x165, script: 0x57, flags: 0x0},
+ 661: {region: 0xb7, script: 0x57, flags: 0x0},
+ 662: {region: 0x106, script: 0x1f, flags: 0x0},
+ 663: {region: 0x165, script: 0x57, flags: 0x0},
+ 664: {region: 0x95, script: 0x57, flags: 0x0},
+ 665: {region: 0x165, script: 0x57, flags: 0x0},
+ 666: {region: 0x53, script: 0xdf, flags: 0x0},
+ 667: {region: 0x165, script: 0x57, flags: 0x0},
+ 668: {region: 0x165, script: 0x57, flags: 0x0},
+ 669: {region: 0x165, script: 0x57, flags: 0x0},
+ 670: {region: 0x165, script: 0x57, flags: 0x0},
+ 671: {region: 0x99, script: 0x59, flags: 0x0},
+ 672: {region: 0x165, script: 0x57, flags: 0x0},
+ 673: {region: 0x165, script: 0x57, flags: 0x0},
+ 674: {region: 0x106, script: 0x1f, flags: 0x0},
+ 675: {region: 0x131, script: 0x57, flags: 0x0},
+ 676: {region: 0x165, script: 0x57, flags: 0x0},
+ 677: {region: 0xd9, script: 0x57, flags: 0x0},
+ 678: {region: 0x165, script: 0x57, flags: 0x0},
+ 679: {region: 0x165, script: 0x57, flags: 0x0},
+ 680: {region: 0x21, script: 0x2, flags: 0x1},
+ 681: {region: 0x165, script: 0x57, flags: 0x0},
+ 682: {region: 0x165, script: 0x57, flags: 0x0},
+ 683: {region: 0x9e, script: 0x57, flags: 0x0},
+ 684: {region: 0x53, script: 0x5d, flags: 0x0},
+ 685: {region: 0x95, script: 0x57, flags: 0x0},
+ 686: {region: 0x9c, script: 0x5, flags: 0x0},
+ 687: {region: 0x135, script: 0x57, flags: 0x0},
+ 688: {region: 0x165, script: 0x57, flags: 0x0},
+ 689: {region: 0x165, script: 0x57, flags: 0x0},
+ 690: {region: 0x99, script: 0xda, flags: 0x0},
+ 691: {region: 0x9e, script: 0x57, flags: 0x0},
+ 692: {region: 0x165, script: 0x57, flags: 0x0},
+ 693: {region: 0x4b, script: 0x57, flags: 0x0},
+ 694: {region: 0x165, script: 0x57, flags: 0x0},
+ 695: {region: 0x165, script: 0x57, flags: 0x0},
+ 696: {region: 0xaf, script: 0x54, flags: 0x0},
+ 697: {region: 0x165, script: 0x57, flags: 0x0},
+ 698: {region: 0x165, script: 0x57, flags: 0x0},
+ 699: {region: 0x4b, script: 0x57, flags: 0x0},
+ 700: {region: 0x165, script: 0x57, flags: 0x0},
+ 701: {region: 0x165, script: 0x57, flags: 0x0},
+ 702: {region: 0x162, script: 0x57, flags: 0x0},
+ 703: {region: 0x9c, script: 0x5, flags: 0x0},
+ 704: {region: 0xb6, script: 0x57, flags: 0x0},
+ 705: {region: 0xb8, script: 0x57, flags: 0x0},
+ 706: {region: 0x4b, script: 0x57, flags: 0x0},
+ 707: {region: 0x4b, script: 0x57, flags: 0x0},
+ 708: {region: 0xa4, script: 0x57, flags: 0x0},
+ 709: {region: 0xa4, script: 0x57, flags: 0x0},
+ 710: {region: 0x9c, script: 0x5, flags: 0x0},
+ 711: {region: 0xb8, script: 0x57, flags: 0x0},
+ 712: {region: 0x123, script: 0xdf, flags: 0x0},
+ 713: {region: 0x53, script: 0x38, flags: 0x0},
+ 714: {region: 0x12b, script: 0x57, flags: 0x0},
+ 715: {region: 0x95, script: 0x57, flags: 0x0},
+ 716: {region: 0x52, script: 0x57, flags: 0x0},
+ 717: {region: 0x99, script: 0x21, flags: 0x0},
+ 718: {region: 0x99, script: 0x21, flags: 0x0},
+ 719: {region: 0x95, script: 0x57, flags: 0x0},
+ 720: {region: 0x23, script: 0x3, flags: 0x1},
+ 721: {region: 0xa4, script: 0x57, flags: 0x0},
+ 722: {region: 0x165, script: 0x57, flags: 0x0},
+ 723: {region: 0xcf, script: 0x57, flags: 0x0},
+ 724: {region: 0x165, script: 0x57, flags: 0x0},
+ 725: {region: 0x165, script: 0x57, flags: 0x0},
+ 726: {region: 0x165, script: 0x57, flags: 0x0},
+ 727: {region: 0x165, script: 0x57, flags: 0x0},
+ 728: {region: 0x165, script: 0x57, flags: 0x0},
+ 729: {region: 0x165, script: 0x57, flags: 0x0},
+ 730: {region: 0x165, script: 0x57, flags: 0x0},
+ 731: {region: 0x165, script: 0x57, flags: 0x0},
+ 732: {region: 0x165, script: 0x57, flags: 0x0},
+ 733: {region: 0x165, script: 0x57, flags: 0x0},
+ 734: {region: 0x165, script: 0x57, flags: 0x0},
+ 735: {region: 0x165, script: 0x5, flags: 0x0},
+ 736: {region: 0x106, script: 0x1f, flags: 0x0},
+ 737: {region: 0xe7, script: 0x57, flags: 0x0},
+ 738: {region: 0x165, script: 0x57, flags: 0x0},
+ 739: {region: 0x95, script: 0x57, flags: 0x0},
+ 740: {region: 0x165, script: 0x29, flags: 0x0},
+ 741: {region: 0x165, script: 0x57, flags: 0x0},
+ 742: {region: 0x165, script: 0x57, flags: 0x0},
+ 743: {region: 0x165, script: 0x57, flags: 0x0},
+ 744: {region: 0x112, script: 0x57, flags: 0x0},
+ 745: {region: 0xa4, script: 0x57, flags: 0x0},
+ 746: {region: 0x165, script: 0x57, flags: 0x0},
+ 747: {region: 0x165, script: 0x57, flags: 0x0},
+ 748: {region: 0x123, script: 0x5, flags: 0x0},
+ 749: {region: 0xcc, script: 0x57, flags: 0x0},
+ 750: {region: 0x165, script: 0x57, flags: 0x0},
+ 751: {region: 0x165, script: 0x57, flags: 0x0},
+ 752: {region: 0x165, script: 0x57, flags: 0x0},
+ 753: {region: 0xbf, script: 0x57, flags: 0x0},
+ 754: {region: 0xd1, script: 0x57, flags: 0x0},
+ 755: {region: 0x165, script: 0x57, flags: 0x0},
+ 756: {region: 0x52, script: 0x57, flags: 0x0},
+ 757: {region: 0xdb, script: 0x21, flags: 0x0},
+ 758: {region: 0x12f, script: 0x57, flags: 0x0},
+ 759: {region: 0xc0, script: 0x57, flags: 0x0},
+ 760: {region: 0x165, script: 0x57, flags: 0x0},
+ 761: {region: 0x165, script: 0x57, flags: 0x0},
+ 762: {region: 0xe0, script: 0x57, flags: 0x0},
+ 763: {region: 0x165, script: 0x57, flags: 0x0},
+ 764: {region: 0x95, script: 0x57, flags: 0x0},
+ 765: {region: 0x9b, script: 0x3a, flags: 0x0},
+ 766: {region: 0x165, script: 0x57, flags: 0x0},
+ 767: {region: 0xc2, script: 0x1f, flags: 0x0},
+ 768: {region: 0x165, script: 0x5, flags: 0x0},
+ 769: {region: 0x165, script: 0x57, flags: 0x0},
+ 770: {region: 0x165, script: 0x57, flags: 0x0},
+ 771: {region: 0x165, script: 0x57, flags: 0x0},
+ 772: {region: 0x99, script: 0x6b, flags: 0x0},
+ 773: {region: 0x165, script: 0x57, flags: 0x0},
+ 774: {region: 0x165, script: 0x57, flags: 0x0},
+ 775: {region: 0x10b, script: 0x57, flags: 0x0},
+ 776: {region: 0x165, script: 0x57, flags: 0x0},
+ 777: {region: 0x165, script: 0x57, flags: 0x0},
+ 778: {region: 0x165, script: 0x57, flags: 0x0},
+ 779: {region: 0x26, script: 0x3, flags: 0x1},
+ 780: {region: 0x165, script: 0x57, flags: 0x0},
+ 781: {region: 0x165, script: 0x57, flags: 0x0},
+ 782: {region: 0x99, script: 0xe, flags: 0x0},
+ 783: {region: 0xc4, script: 0x72, flags: 0x0},
+ 785: {region: 0x165, script: 0x57, flags: 0x0},
+ 786: {region: 0x49, script: 0x57, flags: 0x0},
+ 787: {region: 0x49, script: 0x57, flags: 0x0},
+ 788: {region: 0x37, script: 0x57, flags: 0x0},
+ 789: {region: 0x165, script: 0x57, flags: 0x0},
+ 790: {region: 0x165, script: 0x57, flags: 0x0},
+ 791: {region: 0x165, script: 0x57, flags: 0x0},
+ 792: {region: 0x165, script: 0x57, flags: 0x0},
+ 793: {region: 0x165, script: 0x57, flags: 0x0},
+ 794: {region: 0x165, script: 0x57, flags: 0x0},
+ 795: {region: 0x99, script: 0x21, flags: 0x0},
+ 796: {region: 0xdb, script: 0x21, flags: 0x0},
+ 797: {region: 0x106, script: 0x1f, flags: 0x0},
+ 798: {region: 0x35, script: 0x6f, flags: 0x0},
+ 799: {region: 0x29, script: 0x3, flags: 0x1},
+ 800: {region: 0xcb, script: 0x57, flags: 0x0},
+ 801: {region: 0x165, script: 0x57, flags: 0x0},
+ 802: {region: 0x165, script: 0x57, flags: 0x0},
+ 803: {region: 0x165, script: 0x57, flags: 0x0},
+ 804: {region: 0x99, script: 0x21, flags: 0x0},
+ 805: {region: 0x52, script: 0x57, flags: 0x0},
+ 807: {region: 0x165, script: 0x57, flags: 0x0},
+ 808: {region: 0x135, script: 0x57, flags: 0x0},
+ 809: {region: 0x165, script: 0x57, flags: 0x0},
+ 810: {region: 0x165, script: 0x57, flags: 0x0},
+ 811: {region: 0xe8, script: 0x5, flags: 0x0},
+ 812: {region: 0xc3, script: 0x57, flags: 0x0},
+ 813: {region: 0x99, script: 0x21, flags: 0x0},
+ 814: {region: 0x95, script: 0x57, flags: 0x0},
+ 815: {region: 0x164, script: 0x57, flags: 0x0},
+ 816: {region: 0x165, script: 0x57, flags: 0x0},
+ 817: {region: 0xc4, script: 0x72, flags: 0x0},
+ 818: {region: 0x165, script: 0x57, flags: 0x0},
+ 819: {region: 0x165, script: 0x29, flags: 0x0},
+ 820: {region: 0x106, script: 0x1f, flags: 0x0},
+ 821: {region: 0x165, script: 0x57, flags: 0x0},
+ 822: {region: 0x131, script: 0x57, flags: 0x0},
+ 823: {region: 0x9c, script: 0x63, flags: 0x0},
+ 824: {region: 0x165, script: 0x57, flags: 0x0},
+ 825: {region: 0x165, script: 0x57, flags: 0x0},
+ 826: {region: 0x9c, script: 0x5, flags: 0x0},
+ 827: {region: 0x165, script: 0x57, flags: 0x0},
+ 828: {region: 0x165, script: 0x57, flags: 0x0},
+ 829: {region: 0x165, script: 0x57, flags: 0x0},
+ 830: {region: 0xdd, script: 0x57, flags: 0x0},
+ 831: {region: 0x165, script: 0x57, flags: 0x0},
+ 832: {region: 0x165, script: 0x57, flags: 0x0},
+ 834: {region: 0x165, script: 0x57, flags: 0x0},
+ 835: {region: 0x53, script: 0x38, flags: 0x0},
+ 836: {region: 0x9e, script: 0x57, flags: 0x0},
+ 837: {region: 0xd2, script: 0x57, flags: 0x0},
+ 838: {region: 0x165, script: 0x57, flags: 0x0},
+ 839: {region: 0xda, script: 0x57, flags: 0x0},
+ 840: {region: 0x165, script: 0x57, flags: 0x0},
+ 841: {region: 0x165, script: 0x57, flags: 0x0},
+ 842: {region: 0x165, script: 0x57, flags: 0x0},
+ 843: {region: 0xcf, script: 0x57, flags: 0x0},
+ 844: {region: 0x165, script: 0x57, flags: 0x0},
+ 845: {region: 0x165, script: 0x57, flags: 0x0},
+ 846: {region: 0x164, script: 0x57, flags: 0x0},
+ 847: {region: 0xd1, script: 0x57, flags: 0x0},
+ 848: {region: 0x60, script: 0x57, flags: 0x0},
+ 849: {region: 0xdb, script: 0x21, flags: 0x0},
+ 850: {region: 0x165, script: 0x57, flags: 0x0},
+ 851: {region: 0xdb, script: 0x21, flags: 0x0},
+ 852: {region: 0x165, script: 0x57, flags: 0x0},
+ 853: {region: 0x165, script: 0x57, flags: 0x0},
+ 854: {region: 0xd2, script: 0x57, flags: 0x0},
+ 855: {region: 0x165, script: 0x57, flags: 0x0},
+ 856: {region: 0x165, script: 0x57, flags: 0x0},
+ 857: {region: 0xd1, script: 0x57, flags: 0x0},
+ 858: {region: 0x165, script: 0x57, flags: 0x0},
+ 859: {region: 0xcf, script: 0x57, flags: 0x0},
+ 860: {region: 0xcf, script: 0x57, flags: 0x0},
+ 861: {region: 0x165, script: 0x57, flags: 0x0},
+ 862: {region: 0x165, script: 0x57, flags: 0x0},
+ 863: {region: 0x95, script: 0x57, flags: 0x0},
+ 864: {region: 0x165, script: 0x57, flags: 0x0},
+ 865: {region: 0xdf, script: 0x57, flags: 0x0},
+ 866: {region: 0x165, script: 0x57, flags: 0x0},
+ 867: {region: 0x165, script: 0x57, flags: 0x0},
+ 868: {region: 0x99, script: 0x57, flags: 0x0},
+ 869: {region: 0x165, script: 0x57, flags: 0x0},
+ 870: {region: 0x165, script: 0x57, flags: 0x0},
+ 871: {region: 0xd9, script: 0x57, flags: 0x0},
+ 872: {region: 0x52, script: 0x57, flags: 0x0},
+ 873: {region: 0x165, script: 0x57, flags: 0x0},
+ 874: {region: 0xda, script: 0x57, flags: 0x0},
+ 875: {region: 0x165, script: 0x57, flags: 0x0},
+ 876: {region: 0x52, script: 0x57, flags: 0x0},
+ 877: {region: 0x165, script: 0x57, flags: 0x0},
+ 878: {region: 0x165, script: 0x57, flags: 0x0},
+ 879: {region: 0xda, script: 0x57, flags: 0x0},
+ 880: {region: 0x123, script: 0x53, flags: 0x0},
+ 881: {region: 0x99, script: 0x21, flags: 0x0},
+ 882: {region: 0x10c, script: 0xbf, flags: 0x0},
+ 883: {region: 0x165, script: 0x57, flags: 0x0},
+ 884: {region: 0x165, script: 0x57, flags: 0x0},
+ 885: {region: 0x84, script: 0x78, flags: 0x0},
+ 886: {region: 0x161, script: 0x57, flags: 0x0},
+ 887: {region: 0x165, script: 0x57, flags: 0x0},
+ 888: {region: 0x49, script: 0x17, flags: 0x0},
+ 889: {region: 0x165, script: 0x57, flags: 0x0},
+ 890: {region: 0x161, script: 0x57, flags: 0x0},
+ 891: {region: 0x165, script: 0x57, flags: 0x0},
+ 892: {region: 0x165, script: 0x57, flags: 0x0},
+ 893: {region: 0x165, script: 0x57, flags: 0x0},
+ 894: {region: 0x165, script: 0x57, flags: 0x0},
+ 895: {region: 0x165, script: 0x57, flags: 0x0},
+ 896: {region: 0x117, script: 0x57, flags: 0x0},
+ 897: {region: 0x165, script: 0x57, flags: 0x0},
+ 898: {region: 0x165, script: 0x57, flags: 0x0},
+ 899: {region: 0x135, script: 0x57, flags: 0x0},
+ 900: {region: 0x165, script: 0x57, flags: 0x0},
+ 901: {region: 0x53, script: 0x57, flags: 0x0},
+ 902: {region: 0x165, script: 0x57, flags: 0x0},
+ 903: {region: 0xce, script: 0x57, flags: 0x0},
+ 904: {region: 0x12f, script: 0x57, flags: 0x0},
+ 905: {region: 0x131, script: 0x57, flags: 0x0},
+ 906: {region: 0x80, script: 0x57, flags: 0x0},
+ 907: {region: 0x78, script: 0x57, flags: 0x0},
+ 908: {region: 0x165, script: 0x57, flags: 0x0},
+ 910: {region: 0x165, script: 0x57, flags: 0x0},
+ 911: {region: 0x165, script: 0x57, flags: 0x0},
+ 912: {region: 0x6f, script: 0x57, flags: 0x0},
+ 913: {region: 0x165, script: 0x57, flags: 0x0},
+ 914: {region: 0x165, script: 0x57, flags: 0x0},
+ 915: {region: 0x165, script: 0x57, flags: 0x0},
+ 916: {region: 0x165, script: 0x57, flags: 0x0},
+ 917: {region: 0x99, script: 0x7d, flags: 0x0},
+ 918: {region: 0x165, script: 0x57, flags: 0x0},
+ 919: {region: 0x165, script: 0x5, flags: 0x0},
+ 920: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 921: {region: 0x135, script: 0x7e, flags: 0x0},
+ 922: {region: 0x165, script: 0x5, flags: 0x0},
+ 923: {region: 0xc5, script: 0x7c, flags: 0x0},
+ 924: {region: 0x165, script: 0x57, flags: 0x0},
+ 925: {region: 0x2c, script: 0x3, flags: 0x1},
+ 926: {region: 0xe7, script: 0x57, flags: 0x0},
+ 927: {region: 0x2f, script: 0x2, flags: 0x1},
+ 928: {region: 0xe7, script: 0x57, flags: 0x0},
+ 929: {region: 0x30, script: 0x57, flags: 0x0},
+ 930: {region: 0xf0, script: 0x57, flags: 0x0},
+ 931: {region: 0x165, script: 0x57, flags: 0x0},
+ 932: {region: 0x78, script: 0x57, flags: 0x0},
+ 933: {region: 0xd6, script: 0x57, flags: 0x0},
+ 934: {region: 0x135, script: 0x57, flags: 0x0},
+ 935: {region: 0x49, script: 0x57, flags: 0x0},
+ 936: {region: 0x165, script: 0x57, flags: 0x0},
+ 937: {region: 0x9c, script: 0xe8, flags: 0x0},
+ 938: {region: 0x165, script: 0x57, flags: 0x0},
+ 939: {region: 0x60, script: 0x57, flags: 0x0},
+ 940: {region: 0x165, script: 0x5, flags: 0x0},
+ 941: {region: 0xb0, script: 0x87, flags: 0x0},
+ 943: {region: 0x165, script: 0x57, flags: 0x0},
+ 944: {region: 0x165, script: 0x57, flags: 0x0},
+ 945: {region: 0x99, script: 0x12, flags: 0x0},
+ 946: {region: 0xa4, script: 0x57, flags: 0x0},
+ 947: {region: 0xe9, script: 0x57, flags: 0x0},
+ 948: {region: 0x165, script: 0x57, flags: 0x0},
+ 949: {region: 0x9e, script: 0x57, flags: 0x0},
+ 950: {region: 0x165, script: 0x57, flags: 0x0},
+ 951: {region: 0x165, script: 0x57, flags: 0x0},
+ 952: {region: 0x87, script: 0x31, flags: 0x0},
+ 953: {region: 0x75, script: 0x57, flags: 0x0},
+ 954: {region: 0x165, script: 0x57, flags: 0x0},
+ 955: {region: 0xe8, script: 0x4a, flags: 0x0},
+ 956: {region: 0x9c, script: 0x5, flags: 0x0},
+ 957: {region: 0x1, script: 0x57, flags: 0x0},
+ 958: {region: 0x24, script: 0x5, flags: 0x0},
+ 959: {region: 0x165, script: 0x57, flags: 0x0},
+ 960: {region: 0x41, script: 0x57, flags: 0x0},
+ 961: {region: 0x165, script: 0x57, flags: 0x0},
+ 962: {region: 0x7a, script: 0x57, flags: 0x0},
+ 963: {region: 0x165, script: 0x57, flags: 0x0},
+ 964: {region: 0xe4, script: 0x57, flags: 0x0},
+ 965: {region: 0x89, script: 0x57, flags: 0x0},
+ 966: {region: 0x69, script: 0x57, flags: 0x0},
+ 967: {region: 0x165, script: 0x57, flags: 0x0},
+ 968: {region: 0x99, script: 0x21, flags: 0x0},
+ 969: {region: 0x165, script: 0x57, flags: 0x0},
+ 970: {region: 0x102, script: 0x57, flags: 0x0},
+ 971: {region: 0x95, script: 0x57, flags: 0x0},
+ 972: {region: 0x165, script: 0x57, flags: 0x0},
+ 973: {region: 0x165, script: 0x57, flags: 0x0},
+ 974: {region: 0x9e, script: 0x57, flags: 0x0},
+ 975: {region: 0x165, script: 0x5, flags: 0x0},
+ 976: {region: 0x99, script: 0x57, flags: 0x0},
+ 977: {region: 0x31, script: 0x2, flags: 0x1},
+ 978: {region: 0xdb, script: 0x21, flags: 0x0},
+ 979: {region: 0x35, script: 0xe, flags: 0x0},
+ 980: {region: 0x4e, script: 0x57, flags: 0x0},
+ 981: {region: 0x72, script: 0x57, flags: 0x0},
+ 982: {region: 0x4e, script: 0x57, flags: 0x0},
+ 983: {region: 0x9c, script: 0x5, flags: 0x0},
+ 984: {region: 0x10c, script: 0x57, flags: 0x0},
+ 985: {region: 0x3a, script: 0x57, flags: 0x0},
+ 986: {region: 0x165, script: 0x57, flags: 0x0},
+ 987: {region: 0xd1, script: 0x57, flags: 0x0},
+ 988: {region: 0x104, script: 0x57, flags: 0x0},
+ 989: {region: 0x95, script: 0x57, flags: 0x0},
+ 990: {region: 0x12f, script: 0x57, flags: 0x0},
+ 991: {region: 0x165, script: 0x57, flags: 0x0},
+ 992: {region: 0x165, script: 0x57, flags: 0x0},
+ 993: {region: 0x73, script: 0x57, flags: 0x0},
+ 994: {region: 0x106, script: 0x1f, flags: 0x0},
+ 995: {region: 0x130, script: 0x1f, flags: 0x0},
+ 996: {region: 0x109, script: 0x57, flags: 0x0},
+ 997: {region: 0x107, script: 0x57, flags: 0x0},
+ 998: {region: 0x12f, script: 0x57, flags: 0x0},
+ 999: {region: 0x165, script: 0x57, flags: 0x0},
+ 1000: {region: 0xa2, script: 0x49, flags: 0x0},
+ 1001: {region: 0x99, script: 0x21, flags: 0x0},
+ 1002: {region: 0x80, script: 0x57, flags: 0x0},
+ 1003: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1004: {region: 0xa4, script: 0x57, flags: 0x0},
+ 1005: {region: 0x95, script: 0x57, flags: 0x0},
+ 1006: {region: 0x99, script: 0x57, flags: 0x0},
+ 1007: {region: 0x114, script: 0x57, flags: 0x0},
+ 1008: {region: 0x99, script: 0xc3, flags: 0x0},
+ 1009: {region: 0x165, script: 0x57, flags: 0x0},
+ 1010: {region: 0x165, script: 0x57, flags: 0x0},
+ 1011: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1012: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1013: {region: 0x99, script: 0x21, flags: 0x0},
+ 1014: {region: 0x165, script: 0x5, flags: 0x0},
+ 1015: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1016: {region: 0x7b, script: 0x57, flags: 0x0},
+ 1017: {region: 0x49, script: 0x57, flags: 0x0},
+ 1018: {region: 0x33, script: 0x4, flags: 0x1},
+ 1019: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1020: {region: 0x9c, script: 0x5, flags: 0x0},
+ 1021: {region: 0xda, script: 0x57, flags: 0x0},
+ 1022: {region: 0x4f, script: 0x57, flags: 0x0},
+ 1023: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1024: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1025: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1026: {region: 0x4c, script: 0x57, flags: 0x0},
+ 1027: {region: 0x96, script: 0x7a, flags: 0x0},
+ 1028: {region: 0xb6, script: 0x57, flags: 0x0},
+ 1029: {region: 0x165, script: 0x29, flags: 0x0},
+ 1030: {region: 0x165, script: 0x57, flags: 0x0},
+ 1032: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1033: {region: 0x165, script: 0x57, flags: 0x0},
+ 1034: {region: 0xc4, script: 0x72, flags: 0x0},
+ 1035: {region: 0x165, script: 0x5, flags: 0x0},
+ 1036: {region: 0xb3, script: 0xca, flags: 0x0},
+ 1037: {region: 0x6f, script: 0x57, flags: 0x0},
+ 1038: {region: 0x165, script: 0x57, flags: 0x0},
+ 1039: {region: 0x165, script: 0x57, flags: 0x0},
+ 1040: {region: 0x165, script: 0x57, flags: 0x0},
+ 1041: {region: 0x165, script: 0x57, flags: 0x0},
+ 1042: {region: 0x111, script: 0x57, flags: 0x0},
+ 1043: {region: 0x165, script: 0x57, flags: 0x0},
+ 1044: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1045: {region: 0x165, script: 0x57, flags: 0x0},
+ 1046: {region: 0x10f, script: 0x57, flags: 0x0},
+ 1047: {region: 0x165, script: 0x57, flags: 0x0},
+ 1048: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1049: {region: 0x165, script: 0x57, flags: 0x0},
+ 1050: {region: 0x95, script: 0x57, flags: 0x0},
+ 1051: {region: 0x142, script: 0x57, flags: 0x0},
+ 1052: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1054: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1055: {region: 0x72, script: 0x57, flags: 0x0},
+ 1056: {region: 0x97, script: 0xc0, flags: 0x0},
+ 1057: {region: 0x165, script: 0x57, flags: 0x0},
+ 1058: {region: 0x72, script: 0x57, flags: 0x0},
+ 1059: {region: 0x164, script: 0x57, flags: 0x0},
+ 1060: {region: 0x165, script: 0x57, flags: 0x0},
+ 1061: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1062: {region: 0x165, script: 0x57, flags: 0x0},
+ 1063: {region: 0x165, script: 0x57, flags: 0x0},
+ 1064: {region: 0x165, script: 0x57, flags: 0x0},
+ 1065: {region: 0x115, script: 0x57, flags: 0x0},
+ 1066: {region: 0x165, script: 0x57, flags: 0x0},
+ 1067: {region: 0x165, script: 0x57, flags: 0x0},
+ 1068: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1069: {region: 0x165, script: 0x57, flags: 0x0},
+ 1070: {region: 0x165, script: 0x57, flags: 0x0},
+ 1071: {region: 0x165, script: 0x57, flags: 0x0},
+ 1072: {region: 0x165, script: 0x57, flags: 0x0},
+ 1073: {region: 0x27, script: 0x57, flags: 0x0},
+ 1074: {region: 0x37, script: 0x5, flags: 0x1},
+ 1075: {region: 0x99, script: 0xcb, flags: 0x0},
+ 1076: {region: 0x116, script: 0x57, flags: 0x0},
+ 1077: {region: 0x114, script: 0x57, flags: 0x0},
+ 1078: {region: 0x99, script: 0x21, flags: 0x0},
+ 1079: {region: 0x161, script: 0x57, flags: 0x0},
+ 1080: {region: 0x165, script: 0x57, flags: 0x0},
+ 1081: {region: 0x165, script: 0x57, flags: 0x0},
+ 1082: {region: 0x6d, script: 0x57, flags: 0x0},
+ 1083: {region: 0x161, script: 0x57, flags: 0x0},
+ 1084: {region: 0x165, script: 0x57, flags: 0x0},
+ 1085: {region: 0x60, script: 0x57, flags: 0x0},
+ 1086: {region: 0x95, script: 0x57, flags: 0x0},
+ 1087: {region: 0x165, script: 0x57, flags: 0x0},
+ 1088: {region: 0x165, script: 0x57, flags: 0x0},
+ 1089: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1090: {region: 0x165, script: 0x57, flags: 0x0},
+ 1091: {region: 0x84, script: 0x57, flags: 0x0},
+ 1092: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1093: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1094: {region: 0x15f, script: 0x5, flags: 0x0},
+ 1095: {region: 0x4b, script: 0x57, flags: 0x0},
+ 1096: {region: 0x60, script: 0x57, flags: 0x0},
+ 1097: {region: 0x165, script: 0x57, flags: 0x0},
+ 1098: {region: 0x99, script: 0x21, flags: 0x0},
+ 1099: {region: 0x95, script: 0x57, flags: 0x0},
+ 1100: {region: 0x165, script: 0x57, flags: 0x0},
+ 1101: {region: 0x35, script: 0xe, flags: 0x0},
+ 1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+ 1103: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1104: {region: 0x99, script: 0xd7, flags: 0x0},
+ 1105: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1106: {region: 0x165, script: 0x57, flags: 0x0},
+ 1107: {region: 0x165, script: 0x57, flags: 0x0},
+ 1108: {region: 0x165, script: 0x57, flags: 0x0},
+ 1109: {region: 0x165, script: 0x57, flags: 0x0},
+ 1110: {region: 0x165, script: 0x57, flags: 0x0},
+ 1111: {region: 0x165, script: 0x57, flags: 0x0},
+ 1112: {region: 0x165, script: 0x57, flags: 0x0},
+ 1113: {region: 0x165, script: 0x57, flags: 0x0},
+ 1114: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1115: {region: 0x165, script: 0x57, flags: 0x0},
+ 1116: {region: 0x165, script: 0x57, flags: 0x0},
+ 1117: {region: 0x99, script: 0x4f, flags: 0x0},
+ 1118: {region: 0x53, script: 0xd5, flags: 0x0},
+ 1119: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1120: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1121: {region: 0x99, script: 0xda, flags: 0x0},
+ 1122: {region: 0x165, script: 0x57, flags: 0x0},
+ 1123: {region: 0x112, script: 0x57, flags: 0x0},
+ 1124: {region: 0x131, script: 0x57, flags: 0x0},
+ 1125: {region: 0x126, script: 0x57, flags: 0x0},
+ 1126: {region: 0x165, script: 0x57, flags: 0x0},
+ 1127: {region: 0x3c, script: 0x3, flags: 0x1},
+ 1128: {region: 0x165, script: 0x57, flags: 0x0},
+ 1129: {region: 0x165, script: 0x57, flags: 0x0},
+ 1130: {region: 0x165, script: 0x57, flags: 0x0},
+ 1131: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1132: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1133: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1134: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1135: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1136: {region: 0x165, script: 0x57, flags: 0x0},
+ 1137: {region: 0x6d, script: 0x29, flags: 0x0},
+ 1138: {region: 0x165, script: 0x57, flags: 0x0},
+ 1139: {region: 0x165, script: 0x57, flags: 0x0},
+ 1140: {region: 0x165, script: 0x57, flags: 0x0},
+ 1141: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1142: {region: 0x127, script: 0x57, flags: 0x0},
+ 1143: {region: 0x125, script: 0x57, flags: 0x0},
+ 1144: {region: 0x32, script: 0x57, flags: 0x0},
+ 1145: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1146: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1147: {region: 0x165, script: 0x57, flags: 0x0},
+ 1148: {region: 0x165, script: 0x57, flags: 0x0},
+ 1149: {region: 0x32, script: 0x57, flags: 0x0},
+ 1150: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1151: {region: 0x165, script: 0x57, flags: 0x0},
+ 1152: {region: 0x161, script: 0x57, flags: 0x0},
+ 1153: {region: 0x165, script: 0x57, flags: 0x0},
+ 1154: {region: 0x129, script: 0x57, flags: 0x0},
+ 1155: {region: 0x165, script: 0x57, flags: 0x0},
+ 1156: {region: 0xce, script: 0x57, flags: 0x0},
+ 1157: {region: 0x165, script: 0x57, flags: 0x0},
+ 1158: {region: 0xe6, script: 0x57, flags: 0x0},
+ 1159: {region: 0x165, script: 0x57, flags: 0x0},
+ 1160: {region: 0x165, script: 0x57, flags: 0x0},
+ 1161: {region: 0x165, script: 0x57, flags: 0x0},
+ 1162: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1163: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1164: {region: 0x12e, script: 0x57, flags: 0x0},
+ 1165: {region: 0x165, script: 0x5, flags: 0x0},
+ 1166: {region: 0x161, script: 0x57, flags: 0x0},
+ 1167: {region: 0x87, script: 0x31, flags: 0x0},
+ 1168: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1169: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1170: {region: 0x43, script: 0xe0, flags: 0x0},
+ 1171: {region: 0x165, script: 0x57, flags: 0x0},
+ 1172: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1173: {region: 0x165, script: 0x57, flags: 0x0},
+ 1174: {region: 0x165, script: 0x57, flags: 0x0},
+ 1175: {region: 0x131, script: 0x57, flags: 0x0},
+ 1176: {region: 0x165, script: 0x57, flags: 0x0},
+ 1177: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1178: {region: 0x32, script: 0x57, flags: 0x0},
+ 1179: {region: 0x165, script: 0x57, flags: 0x0},
+ 1180: {region: 0x165, script: 0x57, flags: 0x0},
+ 1181: {region: 0xce, script: 0x57, flags: 0x0},
+ 1182: {region: 0x165, script: 0x57, flags: 0x0},
+ 1183: {region: 0x165, script: 0x57, flags: 0x0},
+ 1184: {region: 0x12d, script: 0x57, flags: 0x0},
+ 1185: {region: 0x165, script: 0x57, flags: 0x0},
+ 1187: {region: 0x165, script: 0x57, flags: 0x0},
+ 1188: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1189: {region: 0x53, script: 0xd8, flags: 0x0},
+ 1190: {region: 0xe5, script: 0x57, flags: 0x0},
+ 1191: {region: 0x165, script: 0x57, flags: 0x0},
+ 1192: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1193: {region: 0xba, script: 0x57, flags: 0x0},
+ 1194: {region: 0x165, script: 0x57, flags: 0x0},
+ 1195: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1196: {region: 0x3f, script: 0x4, flags: 0x1},
+ 1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+ 1198: {region: 0x130, script: 0x1f, flags: 0x0},
+ 1199: {region: 0x75, script: 0x57, flags: 0x0},
+ 1200: {region: 0x2a, script: 0x57, flags: 0x0},
+ 1202: {region: 0x43, script: 0x3, flags: 0x1},
+ 1203: {region: 0x99, script: 0xe, flags: 0x0},
+ 1204: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1205: {region: 0x165, script: 0x57, flags: 0x0},
+ 1206: {region: 0x165, script: 0x57, flags: 0x0},
+ 1207: {region: 0x165, script: 0x57, flags: 0x0},
+ 1208: {region: 0x165, script: 0x57, flags: 0x0},
+ 1209: {region: 0x165, script: 0x57, flags: 0x0},
+ 1210: {region: 0x165, script: 0x57, flags: 0x0},
+ 1211: {region: 0x165, script: 0x57, flags: 0x0},
+ 1212: {region: 0x46, script: 0x4, flags: 0x1},
+ 1213: {region: 0x165, script: 0x57, flags: 0x0},
+ 1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+ 1215: {region: 0x165, script: 0x57, flags: 0x0},
+ 1216: {region: 0x161, script: 0x57, flags: 0x0},
+ 1217: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1218: {region: 0x106, script: 0x57, flags: 0x0},
+ 1219: {region: 0x13e, script: 0x57, flags: 0x0},
+ 1220: {region: 0x11b, script: 0x57, flags: 0x0},
+ 1221: {region: 0x165, script: 0x57, flags: 0x0},
+ 1222: {region: 0x36, script: 0x57, flags: 0x0},
+ 1223: {region: 0x60, script: 0x57, flags: 0x0},
+ 1224: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1225: {region: 0x1, script: 0x57, flags: 0x0},
+ 1226: {region: 0x106, script: 0x57, flags: 0x0},
+ 1227: {region: 0x6a, script: 0x57, flags: 0x0},
+ 1228: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1229: {region: 0x165, script: 0x57, flags: 0x0},
+ 1230: {region: 0x36, script: 0x57, flags: 0x0},
+ 1231: {region: 0x4e, script: 0x57, flags: 0x0},
+ 1232: {region: 0x165, script: 0x57, flags: 0x0},
+ 1233: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1234: {region: 0x165, script: 0x57, flags: 0x0},
+ 1235: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1236: {region: 0x2f, script: 0x57, flags: 0x0},
+ 1237: {region: 0x99, script: 0xda, flags: 0x0},
+ 1238: {region: 0x99, script: 0x21, flags: 0x0},
+ 1239: {region: 0x165, script: 0x57, flags: 0x0},
+ 1240: {region: 0x165, script: 0x57, flags: 0x0},
+ 1241: {region: 0x165, script: 0x57, flags: 0x0},
+ 1242: {region: 0x165, script: 0x57, flags: 0x0},
+ 1243: {region: 0x165, script: 0x57, flags: 0x0},
+ 1244: {region: 0x165, script: 0x57, flags: 0x0},
+ 1245: {region: 0x165, script: 0x57, flags: 0x0},
+ 1246: {region: 0x165, script: 0x57, flags: 0x0},
+ 1247: {region: 0x165, script: 0x57, flags: 0x0},
+ 1248: {region: 0x140, script: 0x57, flags: 0x0},
+ 1249: {region: 0x165, script: 0x57, flags: 0x0},
+ 1250: {region: 0x165, script: 0x57, flags: 0x0},
+ 1251: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1252: {region: 0x165, script: 0x57, flags: 0x0},
+ 1253: {region: 0x114, script: 0x57, flags: 0x0},
+ 1254: {region: 0x165, script: 0x57, flags: 0x0},
+ 1255: {region: 0x165, script: 0x57, flags: 0x0},
+ 1256: {region: 0x165, script: 0x57, flags: 0x0},
+ 1257: {region: 0x165, script: 0x57, flags: 0x0},
+ 1258: {region: 0x99, script: 0x21, flags: 0x0},
+ 1259: {region: 0x53, script: 0x38, flags: 0x0},
+ 1260: {region: 0x165, script: 0x57, flags: 0x0},
+ 1261: {region: 0x165, script: 0x57, flags: 0x0},
+ 1262: {region: 0x41, script: 0x57, flags: 0x0},
+ 1263: {region: 0x165, script: 0x57, flags: 0x0},
+ 1264: {region: 0x12b, script: 0x18, flags: 0x0},
+ 1265: {region: 0x165, script: 0x57, flags: 0x0},
+ 1266: {region: 0x161, script: 0x57, flags: 0x0},
+ 1267: {region: 0x165, script: 0x57, flags: 0x0},
+ 1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+ 1269: {region: 0x12b, script: 0x60, flags: 0x0},
+ 1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 1271: {region: 0x53, script: 0x64, flags: 0x0},
+ 1272: {region: 0x10b, script: 0x69, flags: 0x0},
+ 1273: {region: 0x108, script: 0x73, flags: 0x0},
+ 1274: {region: 0x99, script: 0x21, flags: 0x0},
+ 1275: {region: 0x131, script: 0x57, flags: 0x0},
+ 1276: {region: 0x165, script: 0x57, flags: 0x0},
+ 1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+ 1278: {region: 0x165, script: 0x57, flags: 0x0},
+ 1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+ 1280: {region: 0x165, script: 0x57, flags: 0x0},
+ 1281: {region: 0x165, script: 0x57, flags: 0x0},
+ 1282: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1283: {region: 0x165, script: 0x57, flags: 0x0},
+ 1284: {region: 0x165, script: 0x57, flags: 0x0},
+ 1285: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1286: {region: 0x75, script: 0x57, flags: 0x0},
+ 1287: {region: 0x165, script: 0x57, flags: 0x0},
+ 1288: {region: 0x165, script: 0x57, flags: 0x0},
+ 1289: {region: 0x52, script: 0x57, flags: 0x0},
+ 1290: {region: 0x165, script: 0x57, flags: 0x0},
+ 1291: {region: 0x165, script: 0x57, flags: 0x0},
+ 1292: {region: 0x165, script: 0x57, flags: 0x0},
+ 1293: {region: 0x52, script: 0x57, flags: 0x0},
+ 1294: {region: 0x165, script: 0x57, flags: 0x0},
+ 1295: {region: 0x165, script: 0x57, flags: 0x0},
+ 1296: {region: 0x165, script: 0x57, flags: 0x0},
+ 1297: {region: 0x165, script: 0x57, flags: 0x0},
+ 1298: {region: 0x1, script: 0x3b, flags: 0x0},
+ 1299: {region: 0x165, script: 0x57, flags: 0x0},
+ 1300: {region: 0x165, script: 0x57, flags: 0x0},
+ 1301: {region: 0x165, script: 0x57, flags: 0x0},
+ 1302: {region: 0x165, script: 0x57, flags: 0x0},
+ 1303: {region: 0x165, script: 0x57, flags: 0x0},
+ 1304: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1305: {region: 0x165, script: 0x57, flags: 0x0},
+ 1306: {region: 0x165, script: 0x57, flags: 0x0},
+ 1307: {region: 0x165, script: 0x57, flags: 0x0},
+ 1308: {region: 0x41, script: 0x57, flags: 0x0},
+ 1309: {region: 0x165, script: 0x57, flags: 0x0},
+ 1310: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1311: {region: 0x4a, script: 0x3, flags: 0x1},
+ 1312: {region: 0x165, script: 0x57, flags: 0x0},
+ 1313: {region: 0x165, script: 0x57, flags: 0x0},
+ 1314: {region: 0x165, script: 0x57, flags: 0x0},
+ 1315: {region: 0x53, script: 0x57, flags: 0x0},
+ 1316: {region: 0x10b, script: 0x57, flags: 0x0},
+ 1318: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1319: {region: 0xd9, script: 0x57, flags: 0x0},
+ 1320: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1321: {region: 0x4d, script: 0x14, flags: 0x1},
+ 1322: {region: 0x53, script: 0x79, flags: 0x0},
+ 1323: {region: 0x165, script: 0x57, flags: 0x0},
+ 1324: {region: 0x122, script: 0x57, flags: 0x0},
+ 1325: {region: 0xd0, script: 0x57, flags: 0x0},
+ 1326: {region: 0x165, script: 0x57, flags: 0x0},
+ 1327: {region: 0x161, script: 0x57, flags: 0x0},
+ 1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+ 0: {region: 0x9c, script: 0x7, flags: 0x0},
+ 1: {region: 0xa1, script: 0x74, flags: 0x2},
+ 2: {region: 0x11c, script: 0x80, flags: 0x2},
+ 3: {region: 0x32, script: 0x57, flags: 0x0},
+ 4: {region: 0x9b, script: 0x5, flags: 0x4},
+ 5: {region: 0x9c, script: 0x5, flags: 0x4},
+ 6: {region: 0x106, script: 0x1f, flags: 0x4},
+ 7: {region: 0x9c, script: 0x5, flags: 0x2},
+ 8: {region: 0x106, script: 0x1f, flags: 0x0},
+ 9: {region: 0x38, script: 0x2c, flags: 0x2},
+ 10: {region: 0x135, script: 0x57, flags: 0x0},
+ 11: {region: 0x7b, script: 0xc5, flags: 0x2},
+ 12: {region: 0x114, script: 0x57, flags: 0x0},
+ 13: {region: 0x84, script: 0x1, flags: 0x2},
+ 14: {region: 0x5d, script: 0x1e, flags: 0x0},
+ 15: {region: 0x87, script: 0x5c, flags: 0x2},
+ 16: {region: 0xd6, script: 0x57, flags: 0x0},
+ 17: {region: 0x52, script: 0x5, flags: 0x4},
+ 18: {region: 0x10b, script: 0x5, flags: 0x4},
+ 19: {region: 0xae, script: 0x1f, flags: 0x0},
+ 20: {region: 0x24, script: 0x5, flags: 0x4},
+ 21: {region: 0x53, script: 0x5, flags: 0x4},
+ 22: {region: 0x9c, script: 0x5, flags: 0x4},
+ 23: {region: 0xc5, script: 0x5, flags: 0x4},
+ 24: {region: 0x53, script: 0x5, flags: 0x2},
+ 25: {region: 0x12b, script: 0x57, flags: 0x0},
+ 26: {region: 0xb0, script: 0x5, flags: 0x4},
+ 27: {region: 0x9b, script: 0x5, flags: 0x2},
+ 28: {region: 0xa5, script: 0x1f, flags: 0x0},
+ 29: {region: 0x53, script: 0x5, flags: 0x4},
+ 30: {region: 0x12b, script: 0x57, flags: 0x4},
+ 31: {region: 0x53, script: 0x5, flags: 0x2},
+ 32: {region: 0x12b, script: 0x57, flags: 0x2},
+ 33: {region: 0xdb, script: 0x21, flags: 0x0},
+ 34: {region: 0x99, script: 0x5a, flags: 0x2},
+ 35: {region: 0x83, script: 0x57, flags: 0x0},
+ 36: {region: 0x84, script: 0x78, flags: 0x4},
+ 37: {region: 0x84, script: 0x78, flags: 0x2},
+ 38: {region: 0xc5, script: 0x1f, flags: 0x0},
+ 39: {region: 0x53, script: 0x6d, flags: 0x4},
+ 40: {region: 0x53, script: 0x6d, flags: 0x2},
+ 41: {region: 0xd0, script: 0x57, flags: 0x0},
+ 42: {region: 0x4a, script: 0x5, flags: 0x4},
+ 43: {region: 0x95, script: 0x5, flags: 0x4},
+ 44: {region: 0x99, script: 0x33, flags: 0x0},
+ 45: {region: 0xe8, script: 0x5, flags: 0x4},
+ 46: {region: 0xe8, script: 0x5, flags: 0x2},
+ 47: {region: 0x9c, script: 0x84, flags: 0x0},
+ 48: {region: 0x53, script: 0x85, flags: 0x2},
+ 49: {region: 0xba, script: 0xdc, flags: 0x0},
+ 50: {region: 0xd9, script: 0x57, flags: 0x4},
+ 51: {region: 0xe8, script: 0x5, flags: 0x0},
+ 52: {region: 0x99, script: 0x21, flags: 0x2},
+ 53: {region: 0x99, script: 0x4c, flags: 0x2},
+ 54: {region: 0x99, script: 0xc9, flags: 0x2},
+ 55: {region: 0x105, script: 0x1f, flags: 0x0},
+ 56: {region: 0xbd, script: 0x57, flags: 0x4},
+ 57: {region: 0x104, script: 0x57, flags: 0x4},
+ 58: {region: 0x106, script: 0x57, flags: 0x4},
+ 59: {region: 0x12b, script: 0x57, flags: 0x4},
+ 60: {region: 0x124, script: 0x1f, flags: 0x0},
+ 61: {region: 0xe8, script: 0x5, flags: 0x4},
+ 62: {region: 0xe8, script: 0x5, flags: 0x2},
+ 63: {region: 0x53, script: 0x5, flags: 0x0},
+ 64: {region: 0xae, script: 0x1f, flags: 0x4},
+ 65: {region: 0xc5, script: 0x1f, flags: 0x4},
+ 66: {region: 0xae, script: 0x1f, flags: 0x2},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0xdb, script: 0x21, flags: 0x4},
+ 69: {region: 0xdb, script: 0x21, flags: 0x2},
+ 70: {region: 0x137, script: 0x57, flags: 0x0},
+ 71: {region: 0x24, script: 0x5, flags: 0x4},
+ 72: {region: 0x53, script: 0x1f, flags: 0x4},
+ 73: {region: 0x24, script: 0x5, flags: 0x2},
+ 74: {region: 0x8d, script: 0x39, flags: 0x0},
+ 75: {region: 0x53, script: 0x38, flags: 0x4},
+ 76: {region: 0x53, script: 0x38, flags: 0x2},
+ 77: {region: 0x53, script: 0x38, flags: 0x0},
+ 78: {region: 0x2f, script: 0x39, flags: 0x4},
+ 79: {region: 0x3e, script: 0x39, flags: 0x4},
+ 80: {region: 0x7b, script: 0x39, flags: 0x4},
+ 81: {region: 0x7e, script: 0x39, flags: 0x4},
+ 82: {region: 0x8d, script: 0x39, flags: 0x4},
+ 83: {region: 0x95, script: 0x39, flags: 0x4},
+ 84: {region: 0xc6, script: 0x39, flags: 0x4},
+ 85: {region: 0xd0, script: 0x39, flags: 0x4},
+ 86: {region: 0xe2, script: 0x39, flags: 0x4},
+ 87: {region: 0xe5, script: 0x39, flags: 0x4},
+ 88: {region: 0xe7, script: 0x39, flags: 0x4},
+ 89: {region: 0x116, script: 0x39, flags: 0x4},
+ 90: {region: 0x123, script: 0x39, flags: 0x4},
+ 91: {region: 0x12e, script: 0x39, flags: 0x4},
+ 92: {region: 0x135, script: 0x39, flags: 0x4},
+ 93: {region: 0x13e, script: 0x39, flags: 0x4},
+ 94: {region: 0x12e, script: 0x11, flags: 0x2},
+ 95: {region: 0x12e, script: 0x34, flags: 0x2},
+ 96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+ lang uint16
+ script uint8
+ flags uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+ 34: {lang: 0xd7, script: 0x57, flags: 0x0},
+ 35: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 36: {lang: 0x0, script: 0x2, flags: 0x1},
+ 39: {lang: 0x2, script: 0x2, flags: 0x1},
+ 40: {lang: 0x4, script: 0x2, flags: 0x1},
+ 42: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 43: {lang: 0x0, script: 0x57, flags: 0x0},
+ 44: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 45: {lang: 0x41b, script: 0x57, flags: 0x0},
+ 46: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 48: {lang: 0x367, script: 0x57, flags: 0x0},
+ 49: {lang: 0x444, script: 0x57, flags: 0x0},
+ 50: {lang: 0x58, script: 0x57, flags: 0x0},
+ 51: {lang: 0x6, script: 0x2, flags: 0x1},
+ 53: {lang: 0xa5, script: 0xe, flags: 0x0},
+ 54: {lang: 0x367, script: 0x57, flags: 0x0},
+ 55: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 56: {lang: 0x7e, script: 0x1f, flags: 0x0},
+ 57: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 58: {lang: 0x3d9, script: 0x57, flags: 0x0},
+ 59: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 60: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 62: {lang: 0x31f, script: 0x57, flags: 0x0},
+ 63: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 64: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 65: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 67: {lang: 0x8, script: 0x2, flags: 0x1},
+ 69: {lang: 0x0, script: 0x57, flags: 0x0},
+ 71: {lang: 0x71, script: 0x1f, flags: 0x0},
+ 73: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 74: {lang: 0x31f, script: 0x5, flags: 0x2},
+ 75: {lang: 0x445, script: 0x57, flags: 0x0},
+ 76: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 77: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 78: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 81: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 82: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 83: {lang: 0xa, script: 0x4, flags: 0x1},
+ 84: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 85: {lang: 0x0, script: 0x57, flags: 0x0},
+ 86: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 89: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 90: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 91: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 93: {lang: 0xe, script: 0x2, flags: 0x1},
+ 94: {lang: 0xfa, script: 0x57, flags: 0x0},
+ 96: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 98: {lang: 0x1, script: 0x57, flags: 0x0},
+ 99: {lang: 0x101, script: 0x57, flags: 0x0},
+ 101: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 103: {lang: 0x10, script: 0x2, flags: 0x1},
+ 104: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 105: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 106: {lang: 0x140, script: 0x57, flags: 0x0},
+ 107: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 108: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 109: {lang: 0x46f, script: 0x29, flags: 0x0},
+ 110: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 111: {lang: 0x12, script: 0x2, flags: 0x1},
+ 113: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 114: {lang: 0x151, script: 0x57, flags: 0x0},
+ 115: {lang: 0x1c0, script: 0x21, flags: 0x2},
+ 118: {lang: 0x158, script: 0x57, flags: 0x0},
+ 120: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 122: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 123: {lang: 0x14, script: 0x2, flags: 0x1},
+ 125: {lang: 0x16, script: 0x3, flags: 0x1},
+ 126: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 128: {lang: 0x21, script: 0x57, flags: 0x0},
+ 130: {lang: 0x245, script: 0x57, flags: 0x0},
+ 132: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 133: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 134: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 135: {lang: 0x19, script: 0x2, flags: 0x1},
+ 136: {lang: 0x0, script: 0x57, flags: 0x0},
+ 137: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 139: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 141: {lang: 0x529, script: 0x39, flags: 0x0},
+ 142: {lang: 0x0, script: 0x57, flags: 0x0},
+ 143: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 144: {lang: 0x1d1, script: 0x57, flags: 0x0},
+ 145: {lang: 0x1d4, script: 0x57, flags: 0x0},
+ 146: {lang: 0x1d5, script: 0x57, flags: 0x0},
+ 148: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 149: {lang: 0x1b, script: 0x2, flags: 0x1},
+ 151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
+ 153: {lang: 0x1d, script: 0x3, flags: 0x1},
+ 155: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 156: {lang: 0x20, script: 0x2, flags: 0x1},
+ 157: {lang: 0x1f8, script: 0x57, flags: 0x0},
+ 158: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 161: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 162: {lang: 0x200, script: 0x46, flags: 0x0},
+ 164: {lang: 0x445, script: 0x57, flags: 0x0},
+ 165: {lang: 0x28a, script: 0x1f, flags: 0x0},
+ 166: {lang: 0x22, script: 0x3, flags: 0x1},
+ 168: {lang: 0x25, script: 0x2, flags: 0x1},
+ 170: {lang: 0x254, script: 0x50, flags: 0x0},
+ 171: {lang: 0x254, script: 0x50, flags: 0x0},
+ 172: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+ 175: {lang: 0x27, script: 0x2, flags: 0x1},
+ 176: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 178: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 179: {lang: 0x40c, script: 0xca, flags: 0x0},
+ 181: {lang: 0x43b, script: 0x57, flags: 0x0},
+ 182: {lang: 0x2c0, script: 0x57, flags: 0x0},
+ 183: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 184: {lang: 0x2c7, script: 0x57, flags: 0x0},
+ 185: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 186: {lang: 0x29, script: 0x2, flags: 0x1},
+ 187: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 188: {lang: 0x2b, script: 0x2, flags: 0x1},
+ 189: {lang: 0x432, script: 0x57, flags: 0x0},
+ 190: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 191: {lang: 0x2f1, script: 0x57, flags: 0x0},
+ 194: {lang: 0x2d, script: 0x2, flags: 0x1},
+ 195: {lang: 0xa0, script: 0x57, flags: 0x0},
+ 196: {lang: 0x2f, script: 0x2, flags: 0x1},
+ 197: {lang: 0x31, script: 0x2, flags: 0x1},
+ 198: {lang: 0x33, script: 0x2, flags: 0x1},
+ 200: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 201: {lang: 0x35, script: 0x2, flags: 0x1},
+ 203: {lang: 0x320, script: 0x57, flags: 0x0},
+ 204: {lang: 0x37, script: 0x3, flags: 0x1},
+ 205: {lang: 0x128, script: 0xde, flags: 0x0},
+ 207: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 208: {lang: 0x31f, script: 0x57, flags: 0x0},
+ 209: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 210: {lang: 0x16, script: 0x57, flags: 0x0},
+ 211: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 212: {lang: 0x1b4, script: 0x57, flags: 0x0},
+ 214: {lang: 0x1b4, script: 0x5, flags: 0x2},
+ 216: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 217: {lang: 0x367, script: 0x57, flags: 0x0},
+ 218: {lang: 0x347, script: 0x57, flags: 0x0},
+ 219: {lang: 0x351, script: 0x21, flags: 0x0},
+ 225: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 226: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 228: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 229: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 230: {lang: 0x486, script: 0x57, flags: 0x0},
+ 231: {lang: 0x153, script: 0x57, flags: 0x0},
+ 232: {lang: 0x3a, script: 0x3, flags: 0x1},
+ 233: {lang: 0x3b3, script: 0x57, flags: 0x0},
+ 234: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 236: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 237: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 238: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 240: {lang: 0x3a2, script: 0x57, flags: 0x0},
+ 241: {lang: 0x194, script: 0x57, flags: 0x0},
+ 243: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 258: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 260: {lang: 0x3d, script: 0x2, flags: 0x1},
+ 261: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 262: {lang: 0x3f, script: 0x2, flags: 0x1},
+ 263: {lang: 0x3e5, script: 0x57, flags: 0x0},
+ 264: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 266: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 267: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 268: {lang: 0x41, script: 0x2, flags: 0x1},
+ 271: {lang: 0x416, script: 0x57, flags: 0x0},
+ 272: {lang: 0x347, script: 0x57, flags: 0x0},
+ 273: {lang: 0x43, script: 0x2, flags: 0x1},
+ 275: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 276: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 277: {lang: 0x429, script: 0x57, flags: 0x0},
+ 278: {lang: 0x367, script: 0x57, flags: 0x0},
+ 280: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 282: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 284: {lang: 0x45, script: 0x2, flags: 0x1},
+ 288: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 289: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 290: {lang: 0x47, script: 0x2, flags: 0x1},
+ 291: {lang: 0x49, script: 0x3, flags: 0x1},
+ 292: {lang: 0x4c, script: 0x2, flags: 0x1},
+ 293: {lang: 0x477, script: 0x57, flags: 0x0},
+ 294: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 295: {lang: 0x476, script: 0x57, flags: 0x0},
+ 296: {lang: 0x4e, script: 0x2, flags: 0x1},
+ 297: {lang: 0x482, script: 0x57, flags: 0x0},
+ 299: {lang: 0x50, script: 0x4, flags: 0x1},
+ 301: {lang: 0x4a0, script: 0x57, flags: 0x0},
+ 302: {lang: 0x54, script: 0x2, flags: 0x1},
+ 303: {lang: 0x445, script: 0x57, flags: 0x0},
+ 304: {lang: 0x56, script: 0x3, flags: 0x1},
+ 305: {lang: 0x445, script: 0x57, flags: 0x0},
+ 309: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 310: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 311: {lang: 0x4bc, script: 0x57, flags: 0x0},
+ 312: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 315: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 318: {lang: 0x4c3, script: 0x57, flags: 0x0},
+ 319: {lang: 0x8a, script: 0x57, flags: 0x0},
+ 320: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 322: {lang: 0x41b, script: 0x57, flags: 0x0},
+ 333: {lang: 0x59, script: 0x2, flags: 0x1},
+ 350: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 351: {lang: 0x5b, script: 0x2, flags: 0x1},
+ 356: {lang: 0x423, script: 0x57, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 372 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+ 0: {lang: 0x148, script: 0x5, flags: 0x0},
+ 1: {lang: 0x476, script: 0x57, flags: 0x0},
+ 2: {lang: 0x431, script: 0x57, flags: 0x0},
+ 3: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 4: {lang: 0x1d7, script: 0x8, flags: 0x0},
+ 5: {lang: 0x274, script: 0x57, flags: 0x0},
+ 6: {lang: 0xb7, script: 0x57, flags: 0x0},
+ 7: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 8: {lang: 0x12d, script: 0xe0, flags: 0x0},
+ 9: {lang: 0x351, script: 0x21, flags: 0x0},
+ 10: {lang: 0x529, script: 0x38, flags: 0x0},
+ 11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+ 12: {lang: 0x523, script: 0x57, flags: 0x0},
+ 13: {lang: 0x29a, script: 0xdf, flags: 0x0},
+ 14: {lang: 0x136, script: 0x31, flags: 0x0},
+ 15: {lang: 0x48a, script: 0x57, flags: 0x0},
+ 16: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 17: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 18: {lang: 0x27, script: 0x29, flags: 0x0},
+ 19: {lang: 0x139, script: 0x57, flags: 0x0},
+ 20: {lang: 0x26a, script: 0x5, flags: 0x2},
+ 21: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 22: {lang: 0x210, script: 0x2b, flags: 0x0},
+ 23: {lang: 0x5, script: 0x1f, flags: 0x0},
+ 24: {lang: 0x274, script: 0x57, flags: 0x0},
+ 25: {lang: 0x136, script: 0x31, flags: 0x0},
+ 26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 27: {lang: 0x1e1, script: 0x57, flags: 0x0},
+ 28: {lang: 0x31f, script: 0x5, flags: 0x0},
+ 29: {lang: 0x1be, script: 0x21, flags: 0x0},
+ 30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 31: {lang: 0x236, script: 0x72, flags: 0x0},
+ 32: {lang: 0x148, script: 0x5, flags: 0x0},
+ 33: {lang: 0x476, script: 0x57, flags: 0x0},
+ 34: {lang: 0x24a, script: 0x4b, flags: 0x0},
+ 35: {lang: 0xe6, script: 0x5, flags: 0x0},
+ 36: {lang: 0x226, script: 0xdf, flags: 0x0},
+ 37: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 38: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 39: {lang: 0x2b8, script: 0x54, flags: 0x0},
+ 40: {lang: 0x226, script: 0xdf, flags: 0x0},
+ 41: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 42: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 43: {lang: 0x3dc, script: 0x57, flags: 0x0},
+ 44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 46: {lang: 0x431, script: 0x57, flags: 0x0},
+ 47: {lang: 0x331, script: 0x72, flags: 0x0},
+ 48: {lang: 0x213, script: 0x57, flags: 0x0},
+ 49: {lang: 0x30b, script: 0x1f, flags: 0x0},
+ 50: {lang: 0x242, script: 0x5, flags: 0x0},
+ 51: {lang: 0x529, script: 0x39, flags: 0x0},
+ 52: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 53: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 54: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 55: {lang: 0x2ed, script: 0x57, flags: 0x0},
+ 56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 57: {lang: 0x88, script: 0x21, flags: 0x0},
+ 58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 60: {lang: 0xbe, script: 0x21, flags: 0x0},
+ 61: {lang: 0x3dc, script: 0x57, flags: 0x0},
+ 62: {lang: 0x7e, script: 0x1f, flags: 0x0},
+ 63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+ 64: {lang: 0x267, script: 0x57, flags: 0x0},
+ 65: {lang: 0x444, script: 0x57, flags: 0x0},
+ 66: {lang: 0x512, script: 0x3b, flags: 0x0},
+ 67: {lang: 0x412, script: 0x57, flags: 0x0},
+ 68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 69: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 70: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 71: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 72: {lang: 0x35, script: 0x5, flags: 0x0},
+ 73: {lang: 0x46b, script: 0xdf, flags: 0x0},
+ 74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+ 75: {lang: 0x30f, script: 0x72, flags: 0x0},
+ 76: {lang: 0x467, script: 0x1f, flags: 0x0},
+ 77: {lang: 0x148, script: 0x5, flags: 0x0},
+ 78: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 80: {lang: 0x48a, script: 0x57, flags: 0x0},
+ 81: {lang: 0x58, script: 0x5, flags: 0x0},
+ 82: {lang: 0x219, script: 0x1f, flags: 0x0},
+ 83: {lang: 0x81, script: 0x31, flags: 0x0},
+ 84: {lang: 0x529, script: 0x39, flags: 0x0},
+ 85: {lang: 0x48c, script: 0x57, flags: 0x0},
+ 86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 87: {lang: 0x512, script: 0x3b, flags: 0x0},
+ 88: {lang: 0x3b3, script: 0x57, flags: 0x0},
+ 89: {lang: 0x431, script: 0x57, flags: 0x0},
+ 90: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 91: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+ lang uint16
+ region uint16
+ script uint8
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+ 1: {lang: 0x139, region: 0xd6, script: 0x57},
+ 2: {lang: 0x139, region: 0x135, script: 0x57},
+ 3: {lang: 0x3c0, region: 0x41, script: 0x57},
+ 4: {lang: 0x139, region: 0x2f, script: 0x57},
+ 5: {lang: 0x139, region: 0xd6, script: 0x57},
+ 6: {lang: 0x13e, region: 0xcf, script: 0x57},
+ 7: {lang: 0x445, region: 0x12f, script: 0x57},
+ 8: {lang: 0x3a, region: 0x6b, script: 0x5},
+ 9: {lang: 0x445, region: 0x4b, script: 0x57},
+ 10: {lang: 0x139, region: 0x161, script: 0x57},
+ 11: {lang: 0x139, region: 0x135, script: 0x57},
+ 12: {lang: 0x139, region: 0x135, script: 0x57},
+ 13: {lang: 0x13e, region: 0x59, script: 0x57},
+ 14: {lang: 0x529, region: 0x53, script: 0x38},
+ 15: {lang: 0x1be, region: 0x99, script: 0x21},
+ 16: {lang: 0x1e1, region: 0x95, script: 0x57},
+ 17: {lang: 0x1f9, region: 0x9e, script: 0x57},
+ 18: {lang: 0x139, region: 0x2f, script: 0x57},
+ 19: {lang: 0x139, region: 0xe6, script: 0x57},
+ 20: {lang: 0x139, region: 0x8a, script: 0x57},
+ 21: {lang: 0x41b, region: 0x142, script: 0x57},
+ 22: {lang: 0x529, region: 0x53, script: 0x38},
+ 23: {lang: 0x4bc, region: 0x137, script: 0x57},
+ 24: {lang: 0x3a, region: 0x108, script: 0x5},
+ 25: {lang: 0x3e2, region: 0x106, script: 0x1f},
+ 26: {lang: 0x3e2, region: 0x106, script: 0x1f},
+ 27: {lang: 0x139, region: 0x7b, script: 0x57},
+ 28: {lang: 0x10d, region: 0x60, script: 0x57},
+ 29: {lang: 0x139, region: 0xd6, script: 0x57},
+ 30: {lang: 0x13e, region: 0x1f, script: 0x57},
+ 31: {lang: 0x139, region: 0x9a, script: 0x57},
+ 32: {lang: 0x139, region: 0x7b, script: 0x57},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+ // Entry 0 - 1F
+ 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+ 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+ 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+ 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+ 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+ 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+ 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+ // Entry 20 - 3F
+ 0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 358 bytes, 358 elements
+var regionInclusion = [358]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+ 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+ 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+ 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+ 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+ 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+ 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+ 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+ // Entry 40 - 7F
+ 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+ 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+ 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
+ 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
+ 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
+ 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
+ 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
+ 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+ // Entry 80 - BF
+ 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
+ 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
+ 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
+ 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
+ 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
+ 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
+ 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
+ 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+ // Entry C0 - FF
+ 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
+ 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
+ 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
+ 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
+ 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
+ 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
+ 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ // Entry 100 - 13F
+ 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
+ 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
+ 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
+ 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
+ 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
+ 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
+ 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
+ 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+ // Entry 140 - 17F
+ 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
+ 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings. These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+ // Entry 0 - 1F
+ 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+ 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+ 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+ 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+ 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+ 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+ 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+ 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+ // Entry 20 - 3F
+ 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+ 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+ 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+ 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+ 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+ 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+ 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+ // Entry 40 - 5F
+ 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+ 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+ 0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+ // Entry 0 - 3F
+ 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+ 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+ 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+ 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+ 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+ 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+ 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+ 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+ // Entry 40 - 7F
+ 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+ 0x43,
+}
+
+type parentRel struct {
+ lang uint16
+ script uint8
+ maxScript uint8
+ toRegion uint16
+ fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+ 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
+ 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
+ 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
+ 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
+ 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+}
+
+// Total table size 25886 bytes (25KiB); checksum: 50D3D57D
diff --git a/src/dma/vendor/golang.org/x/text/internal/language/tags.go b/src/dma/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 00000000..e7afd318
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+ t, err := Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+ b, err := ParseBase(s)
+ if err != nil {
+ panic(err)
+ }
+ return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+ scr, err := ParseScript(s)
+ if err != nil {
+ panic(err)
+ }
+ return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+ r, err := ParseRegion(s)
+ if err != nil {
+ panic(err)
+ }
+ return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/src/dma/vendor/golang.org/x/text/internal/tag/tag.go b/src/dma/vendor/golang.org/x/text/internal/tag/tag.go
new file mode 100644
index 00000000..b5d34889
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/tag/tag.go
@@ -0,0 +1,100 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package tag contains functionality handling tags and related data.
+package tag // import "golang.org/x/text/internal/tag"
+
+import "sort"
+
+// An Index converts tags to a compact numeric value.
+//
+// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can
+// be used to store additional information about the tag.
+type Index string
+
+// Elem returns the element data at the given index.
+func (s Index) Elem(x int) string {
+ return string(s[x*4 : x*4+4])
+}
+
+// Index reports the index of the given key or -1 if it could not be found.
+// Only the first len(key) bytes from the start of the 4-byte entries will be
+// considered for the search and the first match in Index will be returned.
+func (s Index) Index(key []byte) int {
+ n := len(key)
+ // search the index of the first entry with an equal or higher value than
+ // key in s.
+ index := sort.Search(len(s)/4, func(i int) bool {
+ return cmp(s[i*4:i*4+n], key) != -1
+ })
+ i := index * 4
+ if cmp(s[i:i+len(key)], key) != 0 {
+ return -1
+ }
+ return index
+}
+
+// Next finds the next occurrence of key after index x, which must have been
+// obtained from a call to Index using the same key. It returns x+1 or -1.
+func (s Index) Next(key []byte, x int) int {
+ if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 {
+ return x
+ }
+ return -1
+}
+
+// cmp returns an integer comparing a and b lexicographically.
+func cmp(a Index, b []byte) int {
+ n := len(a)
+ if len(b) < n {
+ n = len(b)
+ }
+ for i, c := range b[:n] {
+ switch {
+ case a[i] > c:
+ return 1
+ case a[i] < c:
+ return -1
+ }
+ }
+ switch {
+ case len(a) < len(b):
+ return -1
+ case len(a) > len(b):
+ return 1
+ }
+ return 0
+}
+
+// Compare returns an integer comparing a and b lexicographically.
+func Compare(a string, b []byte) int {
+ return cmp(Index(a), b)
+}
+
+// FixCase reformats b to the same pattern of cases as form.
+// If returns false if string b is malformed.
+func FixCase(form string, b []byte) bool {
+ if len(form) != len(b) {
+ return false
+ }
+ for i, c := range b {
+ if form[i] <= 'Z' {
+ if c >= 'a' {
+ c -= 'z' - 'Z'
+ }
+ if c < 'A' || 'Z' < c {
+ return false
+ }
+ } else {
+ if c <= 'Z' {
+ c += 'z' - 'Z'
+ }
+ if c < 'a' || 'z' < c {
+ return false
+ }
+ }
+ b[i] = c
+ }
+ return true
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/triegen/compact.go b/src/dma/vendor/golang.org/x/text/internal/triegen/compact.go
new file mode 100644
index 00000000..397b975c
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/triegen/compact.go
@@ -0,0 +1,58 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package triegen
+
+// This file defines Compacter and its implementations.
+
+import "io"
+
+// A Compacter generates an alternative, more space-efficient way to store a
+// trie value block. A trie value block holds all possible values for the last
+// byte of a UTF-8 encoded rune. Excluding ASCII characters, a trie value block
+// always has 64 values, as a UTF-8 encoding ends with a byte in [0x80, 0xC0).
+type Compacter interface {
+ // Size returns whether the Compacter could encode the given block as well
+ // as its size in case it can. len(v) is always 64.
+ Size(v []uint64) (sz int, ok bool)
+
+ // Store stores the block using the Compacter's compression method.
+ // It returns a handle with which the block can be retrieved.
+ // len(v) is always 64.
+ Store(v []uint64) uint32
+
+ // Print writes the data structures associated to the given store to w.
+ Print(w io.Writer) error
+
+ // Handler returns the name of a function that gets called during trie
+ // lookup for blocks generated by the Compacter. The function should be of
+ // the form func (n uint32, b byte) uint64, where n is the index returned by
+ // the Compacter's Store method and b is the last byte of the UTF-8
+ // encoding, where 0x80 <= b < 0xC0, for which to do the lookup in the
+ // block.
+ Handler() string
+}
+
+// simpleCompacter is the default Compacter used by builder. It implements a
+// normal trie block.
+type simpleCompacter builder
+
+func (b *simpleCompacter) Size([]uint64) (sz int, ok bool) {
+ return blockSize * b.ValueSize, true
+}
+
+func (b *simpleCompacter) Store(v []uint64) uint32 {
+ h := uint32(len(b.ValueBlocks) - blockOffset)
+ b.ValueBlocks = append(b.ValueBlocks, v)
+ return h
+}
+
+func (b *simpleCompacter) Print(io.Writer) error {
+ // Structures are printed in print.go.
+ return nil
+}
+
+func (b *simpleCompacter) Handler() string {
+ panic("Handler should be special-cased for this Compacter")
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/triegen/print.go b/src/dma/vendor/golang.org/x/text/internal/triegen/print.go
new file mode 100644
index 00000000..8d9f120b
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/triegen/print.go
@@ -0,0 +1,251 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package triegen
+
+import (
+ "bytes"
+ "fmt"
+ "io"
+ "strings"
+ "text/template"
+)
+
+// print writes all the data structures as well as the code necessary to use the
+// trie to w.
+func (b *builder) print(w io.Writer) error {
+ b.Stats.NValueEntries = len(b.ValueBlocks) * blockSize
+ b.Stats.NValueBytes = len(b.ValueBlocks) * blockSize * b.ValueSize
+ b.Stats.NIndexEntries = len(b.IndexBlocks) * blockSize
+ b.Stats.NIndexBytes = len(b.IndexBlocks) * blockSize * b.IndexSize
+ b.Stats.NHandleBytes = len(b.Trie) * 2 * b.IndexSize
+
+ // If we only have one root trie, all starter blocks are at position 0 and
+ // we can access the arrays directly.
+ if len(b.Trie) == 1 {
+ // At this point we cannot refer to the generated tables directly.
+ b.ASCIIBlock = b.Name + "Values"
+ b.StarterBlock = b.Name + "Index"
+ } else {
+ // Otherwise we need to have explicit starter indexes in the trie
+ // structure.
+ b.ASCIIBlock = "t.ascii"
+ b.StarterBlock = "t.utf8Start"
+ }
+
+ b.SourceType = "[]byte"
+ if err := lookupGen.Execute(w, b); err != nil {
+ return err
+ }
+
+ b.SourceType = "string"
+ if err := lookupGen.Execute(w, b); err != nil {
+ return err
+ }
+
+ if err := trieGen.Execute(w, b); err != nil {
+ return err
+ }
+
+ for _, c := range b.Compactions {
+ if err := c.c.Print(w); err != nil {
+ return err
+ }
+ }
+
+ return nil
+}
+
+func printValues(n int, values []uint64) string {
+ w := &bytes.Buffer{}
+ boff := n * blockSize
+ fmt.Fprintf(w, "\t// Block %#x, offset %#x", n, boff)
+ var newline bool
+ for i, v := range values {
+ if i%6 == 0 {
+ newline = true
+ }
+ if v != 0 {
+ if newline {
+ fmt.Fprintf(w, "\n")
+ newline = false
+ }
+ fmt.Fprintf(w, "\t%#02x:%#04x, ", boff+i, v)
+ }
+ }
+ return w.String()
+}
+
+func printIndex(b *builder, nr int, n *node) string {
+ w := &bytes.Buffer{}
+ boff := nr * blockSize
+ fmt.Fprintf(w, "\t// Block %#x, offset %#x", nr, boff)
+ var newline bool
+ for i, c := range n.children {
+ if i%8 == 0 {
+ newline = true
+ }
+ if c != nil {
+ v := b.Compactions[c.index.compaction].Offset + uint32(c.index.index)
+ if v != 0 {
+ if newline {
+ fmt.Fprintf(w, "\n")
+ newline = false
+ }
+ fmt.Fprintf(w, "\t%#02x:%#02x, ", boff+i, v)
+ }
+ }
+ }
+ return w.String()
+}
+
+var (
+ trieGen = template.Must(template.New("trie").Funcs(template.FuncMap{
+ "printValues": printValues,
+ "printIndex": printIndex,
+ "title": strings.Title,
+ "dec": func(x int) int { return x - 1 },
+ "psize": func(n int) string {
+ return fmt.Sprintf("%d bytes (%.2f KiB)", n, float64(n)/1024)
+ },
+ }).Parse(trieTemplate))
+ lookupGen = template.Must(template.New("lookup").Parse(lookupTemplate))
+)
+
+// TODO: consider the return type of lookup. It could be uint64, even if the
+// internal value type is smaller. We will have to verify this with the
+// performance of unicode/norm, which is very sensitive to such changes.
+const trieTemplate = `{{$b := .}}{{$multi := gt (len .Trie) 1}}
+// {{.Name}}Trie. Total size: {{psize .Size}}. Checksum: {{printf "%08x" .Checksum}}.
+type {{.Name}}Trie struct { {{if $multi}}
+ ascii []{{.ValueType}} // index for ASCII bytes
+ utf8Start []{{.IndexType}} // index for UTF-8 bytes >= 0xC0
+{{end}}}
+
+func new{{title .Name}}Trie(i int) *{{.Name}}Trie { {{if $multi}}
+ h := {{.Name}}TrieHandles[i]
+ return &{{.Name}}Trie{ {{.Name}}Values[uint32(h.ascii)<<6:], {{.Name}}Index[uint32(h.multi)<<6:] }
+}
+
+type {{.Name}}TrieHandle struct {
+ ascii, multi {{.IndexType}}
+}
+
+// {{.Name}}TrieHandles: {{len .Trie}} handles, {{.Stats.NHandleBytes}} bytes
+var {{.Name}}TrieHandles = [{{len .Trie}}]{{.Name}}TrieHandle{
+{{range .Trie}} { {{.ASCIIIndex}}, {{.StarterIndex}} }, // {{printf "%08x" .Checksum}}: {{.Name}}
+{{end}}}{{else}}
+ return &{{.Name}}Trie{}
+}
+{{end}}
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *{{.Name}}Trie) lookupValue(n uint32, b byte) {{.ValueType}}{{$last := dec (len .Compactions)}} {
+ switch { {{range $i, $c := .Compactions}}
+ {{if eq $i $last}}default{{else}}case n < {{$c.Cutoff}}{{end}}:{{if ne $i 0}}
+ n -= {{$c.Offset}}{{end}}
+ return {{print $b.ValueType}}({{$c.Handler}}){{end}}
+ }
+}
+
+// {{.Name}}Values: {{len .ValueBlocks}} blocks, {{.Stats.NValueEntries}} entries, {{.Stats.NValueBytes}} bytes
+// The third block is the zero block.
+var {{.Name}}Values = [{{.Stats.NValueEntries}}]{{.ValueType}} {
+{{range $i, $v := .ValueBlocks}}{{printValues $i $v}}
+{{end}}}
+
+// {{.Name}}Index: {{len .IndexBlocks}} blocks, {{.Stats.NIndexEntries}} entries, {{.Stats.NIndexBytes}} bytes
+// Block 0 is the zero block.
+var {{.Name}}Index = [{{.Stats.NIndexEntries}}]{{.IndexType}} {
+{{range $i, $v := .IndexBlocks}}{{printIndex $b $i $v}}
+{{end}}}
+`
+
+// TODO: consider allowing zero-length strings after evaluating performance with
+// unicode/norm.
+const lookupTemplate = `
+// lookup{{if eq .SourceType "string"}}String{{end}} returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}(s {{.SourceType}}) (v {{.ValueType}}, sz int) {
+ c0 := s[0]
+ switch {
+ case c0 < 0x80: // is ASCII
+ return {{.ASCIIBlock}}[c0], 1
+ case c0 < 0xC2:
+ return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+ case c0 < 0xE0: // 2-byte UTF-8
+ if len(s) < 2 {
+ return 0, 0
+ }
+ i := {{.StarterBlock}}[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c1), 2
+ case c0 < 0xF0: // 3-byte UTF-8
+ if len(s) < 3 {
+ return 0, 0
+ }
+ i := {{.StarterBlock}}[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = {{.Name}}Index[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c2), 3
+ case c0 < 0xF8: // 4-byte UTF-8
+ if len(s) < 4 {
+ return 0, 0
+ }
+ i := {{.StarterBlock}}[c0]
+ c1 := s[1]
+ if c1 < 0x80 || 0xC0 <= c1 {
+ return 0, 1 // Illegal UTF-8: not a continuation byte.
+ }
+ o := uint32(i)<<6 + uint32(c1)
+ i = {{.Name}}Index[o]
+ c2 := s[2]
+ if c2 < 0x80 || 0xC0 <= c2 {
+ return 0, 2 // Illegal UTF-8: not a continuation byte.
+ }
+ o = uint32(i)<<6 + uint32(c2)
+ i = {{.Name}}Index[o]
+ c3 := s[3]
+ if c3 < 0x80 || 0xC0 <= c3 {
+ return 0, 3 // Illegal UTF-8: not a continuation byte.
+ }
+ return t.lookupValue(uint32(i), c3), 4
+ }
+ // Illegal rune
+ return 0, 1
+}
+
+// lookup{{if eq .SourceType "string"}}String{{end}}Unsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}Unsafe(s {{.SourceType}}) {{.ValueType}} {
+ c0 := s[0]
+ if c0 < 0x80 { // is ASCII
+ return {{.ASCIIBlock}}[c0]
+ }
+ i := {{.StarterBlock}}[c0]
+ if c0 < 0xE0 { // 2-byte UTF-8
+ return t.lookupValue(uint32(i), s[1])
+ }
+ i = {{.Name}}Index[uint32(i)<<6+uint32(s[1])]
+ if c0 < 0xF0 { // 3-byte UTF-8
+ return t.lookupValue(uint32(i), s[2])
+ }
+ i = {{.Name}}Index[uint32(i)<<6+uint32(s[2])]
+ if c0 < 0xF8 { // 4-byte UTF-8
+ return t.lookupValue(uint32(i), s[3])
+ }
+ return 0
+}
+`
diff --git a/src/dma/vendor/golang.org/x/text/internal/triegen/triegen.go b/src/dma/vendor/golang.org/x/text/internal/triegen/triegen.go
new file mode 100644
index 00000000..51d218a3
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/triegen/triegen.go
@@ -0,0 +1,494 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package triegen implements a code generator for a trie for associating
+// unsigned integer values with UTF-8 encoded runes.
+//
+// Many of the go.text packages use tries for storing per-rune information. A
+// trie is especially useful if many of the runes have the same value. If this
+// is the case, many blocks can be expected to be shared allowing for
+// information on many runes to be stored in little space.
+//
+// As most of the lookups are done directly on []byte slices, the tries use the
+// UTF-8 bytes directly for the lookup. This saves a conversion from UTF-8 to
+// runes and contributes a little bit to better performance. It also naturally
+// provides a fast path for ASCII.
+//
+// Space is also an issue. There are many code points defined in Unicode and as
+// a result tables can get quite large. So every byte counts. The triegen
+// package automatically chooses the smallest integer values to represent the
+// tables. Compacters allow further compression of the trie by allowing for
+// alternative representations of individual trie blocks.
+//
+// triegen allows generating multiple tries as a single structure. This is
+// useful when, for example, one wants to generate tries for several languages
+// that have a lot of values in common. Some existing libraries for
+// internationalization store all per-language data as a dynamically loadable
+// chunk. The go.text packages are designed with the assumption that the user
+// typically wants to compile in support for all supported languages, in line
+// with the approach common to Go to create a single standalone binary. The
+// multi-root trie approach can give significant storage savings in this
+// scenario.
+//
+// triegen generates both tables and code. The code is optimized to use the
+// automatically chosen data types. The following code is generated for a Trie
+// or multiple Tries named "foo":
+// - type fooTrie
+// The trie type.
+//
+// - func newFooTrie(x int) *fooTrie
+// Trie constructor, where x is the index of the trie passed to Gen.
+//
+// - func (t *fooTrie) lookup(s []byte) (v uintX, sz int)
+// The lookup method, where uintX is automatically chosen.
+//
+// - func lookupString, lookupUnsafe and lookupStringUnsafe
+// Variants of the above.
+//
+// - var fooValues and fooIndex and any tables generated by Compacters.
+// The core trie data.
+//
+// - var fooTrieHandles
+// Indexes of starter blocks in case of multiple trie roots.
+//
+// It is recommended that users test the generated trie by checking the returned
+// value for every rune. Such exhaustive tests are possible as the number of
+// runes in Unicode is limited.
+package triegen // import "golang.org/x/text/internal/triegen"
+
+// TODO: Arguably, the internally optimized data types would not have to be
+// exposed in the generated API. We could also investigate not generating the
+// code, but using it through a package. We would have to investigate the impact
+// on performance of making such change, though. For packages like unicode/norm,
+// small changes like this could tank performance.
+
+import (
+ "encoding/binary"
+ "fmt"
+ "hash/crc64"
+ "io"
+ "log"
+ "unicode/utf8"
+)
+
+// builder builds a set of tries for associating values with runes. The set of
+// tries can share common index and value blocks.
+type builder struct {
+ Name string
+
+ // ValueType is the type of the trie values looked up.
+ ValueType string
+
+ // ValueSize is the byte size of the ValueType.
+ ValueSize int
+
+ // IndexType is the type of trie index values used for all UTF-8 bytes of
+ // a rune except the last one.
+ IndexType string
+
+ // IndexSize is the byte size of the IndexType.
+ IndexSize int
+
+ // SourceType is used when generating the lookup functions. If the user
+ // requests StringSupport, all lookup functions will be generated for
+ // string input as well.
+ SourceType string
+
+ Trie []*Trie
+
+ IndexBlocks []*node
+ ValueBlocks [][]uint64
+ Compactions []compaction
+ Checksum uint64
+
+ ASCIIBlock string
+ StarterBlock string
+
+ indexBlockIdx map[uint64]int
+ valueBlockIdx map[uint64]nodeIndex
+ asciiBlockIdx map[uint64]int
+
+ // Stats are used to fill out the template.
+ Stats struct {
+ NValueEntries int
+ NValueBytes int
+ NIndexEntries int
+ NIndexBytes int
+ NHandleBytes int
+ }
+
+ err error
+}
+
+// A nodeIndex encodes the index of a node, which is defined by the compaction
+// which stores it and an index within the compaction. For internal nodes, the
+// compaction is always 0.
+type nodeIndex struct {
+ compaction int
+ index int
+}
+
+// compaction keeps track of stats used for the compaction.
+type compaction struct {
+ c Compacter
+ blocks []*node
+ maxHandle uint32
+ totalSize int
+
+ // Used by template-based generator and thus exported.
+ Cutoff uint32
+ Offset uint32
+ Handler string
+}
+
+func (b *builder) setError(err error) {
+ if b.err == nil {
+ b.err = err
+ }
+}
+
+// An Option can be passed to Gen.
+type Option func(b *builder) error
+
+// Compact configures the trie generator to use the given Compacter.
+func Compact(c Compacter) Option {
+ return func(b *builder) error {
+ b.Compactions = append(b.Compactions, compaction{
+ c: c,
+ Handler: c.Handler() + "(n, b)"})
+ return nil
+ }
+}
+
+// Gen writes Go code for a shared trie lookup structure to w for the given
+// Tries. The generated trie type will be called nameTrie. newNameTrie(x) will
+// return the *nameTrie for tries[x]. A value can be looked up by using one of
+// the various lookup methods defined on nameTrie. It returns the table size of
+// the generated trie.
+func Gen(w io.Writer, name string, tries []*Trie, opts ...Option) (sz int, err error) {
+ // The index contains two dummy blocks, followed by the zero block. The zero
+ // block is at offset 0x80, so that the offset for the zero block for
+ // continuation bytes is 0.
+ b := &builder{
+ Name: name,
+ Trie: tries,
+ IndexBlocks: []*node{{}, {}, {}},
+ Compactions: []compaction{{
+ Handler: name + "Values[n<<6+uint32(b)]",
+ }},
+ // The 0 key in indexBlockIdx and valueBlockIdx is the hash of the zero
+ // block.
+ indexBlockIdx: map[uint64]int{0: 0},
+ valueBlockIdx: map[uint64]nodeIndex{0: {}},
+ asciiBlockIdx: map[uint64]int{},
+ }
+ b.Compactions[0].c = (*simpleCompacter)(b)
+
+ for _, f := range opts {
+ if err := f(b); err != nil {
+ return 0, err
+ }
+ }
+ b.build()
+ if b.err != nil {
+ return 0, b.err
+ }
+ if err = b.print(w); err != nil {
+ return 0, err
+ }
+ return b.Size(), nil
+}
+
+// A Trie represents a single root node of a trie. A builder may build several
+// overlapping tries at once.
+type Trie struct {
+ root *node
+
+ hiddenTrie
+}
+
+// hiddenTrie contains values we want to be visible to the template generator,
+// but hidden from the API documentation.
+type hiddenTrie struct {
+ Name string
+ Checksum uint64
+ ASCIIIndex int
+ StarterIndex int
+}
+
+// NewTrie returns a new trie root.
+func NewTrie(name string) *Trie {
+ return &Trie{
+ &node{
+ children: make([]*node, blockSize),
+ values: make([]uint64, utf8.RuneSelf),
+ },
+ hiddenTrie{Name: name},
+ }
+}
+
+// Gen is a convenience wrapper around the Gen func passing t as the only trie
+// and uses the name passed to NewTrie. It returns the size of the generated
+// tables.
+func (t *Trie) Gen(w io.Writer, opts ...Option) (sz int, err error) {
+ return Gen(w, t.Name, []*Trie{t}, opts...)
+}
+
+// node is a node of the intermediate trie structure.
+type node struct {
+ // children holds this node's children. It is always of length 64.
+ // A child node may be nil.
+ children []*node
+
+ // values contains the values of this node. If it is non-nil, this node is
+ // either a root or leaf node:
+ // For root nodes, len(values) == 128 and it maps the bytes in [0x00, 0x7F].
+ // For leaf nodes, len(values) == 64 and it maps the bytes in [0x80, 0xBF].
+ values []uint64
+
+ index nodeIndex
+}
+
+// Insert associates value with the given rune. Insert will panic if a non-zero
+// value is passed for an invalid rune.
+func (t *Trie) Insert(r rune, value uint64) {
+ if value == 0 {
+ return
+ }
+ s := string(r)
+ if []rune(s)[0] != r && value != 0 {
+ // Note: The UCD tables will always assign what amounts to a zero value
+ // to a surrogate. Allowing a zero value for an illegal rune allows
+ // users to iterate over [0..MaxRune] without having to explicitly
+ // exclude surrogates, which would be tedious.
+ panic(fmt.Sprintf("triegen: non-zero value for invalid rune %U", r))
+ }
+ if len(s) == 1 {
+ // It is a root node value (ASCII).
+ t.root.values[s[0]] = value
+ return
+ }
+
+ n := t.root
+ for ; len(s) > 1; s = s[1:] {
+ if n.children == nil {
+ n.children = make([]*node, blockSize)
+ }
+ p := s[0] % blockSize
+ c := n.children[p]
+ if c == nil {
+ c = &node{}
+ n.children[p] = c
+ }
+ if len(s) > 2 && c.values != nil {
+ log.Fatalf("triegen: insert(%U): found internal node with values", r)
+ }
+ n = c
+ }
+ if n.values == nil {
+ n.values = make([]uint64, blockSize)
+ }
+ if n.children != nil {
+ log.Fatalf("triegen: insert(%U): found leaf node that also has child nodes", r)
+ }
+ n.values[s[0]-0x80] = value
+}
+
+// Size returns the number of bytes the generated trie will take to store. It
+// needs to be exported as it is used in the templates.
+func (b *builder) Size() int {
+ // Index blocks.
+ sz := len(b.IndexBlocks) * blockSize * b.IndexSize
+
+ // Skip the first compaction, which represents the normal value blocks, as
+ // its totalSize does not account for the ASCII blocks, which are managed
+ // separately.
+ sz += len(b.ValueBlocks) * blockSize * b.ValueSize
+ for _, c := range b.Compactions[1:] {
+ sz += c.totalSize
+ }
+
+ // TODO: this computation does not account for the fixed overhead of a using
+ // a compaction, either code or data. As for data, though, the typical
+ // overhead of data is in the order of bytes (2 bytes for cases). Further,
+ // the savings of using a compaction should anyway be substantial for it to
+ // be worth it.
+
+ // For multi-root tries, we also need to account for the handles.
+ if len(b.Trie) > 1 {
+ sz += 2 * b.IndexSize * len(b.Trie)
+ }
+ return sz
+}
+
+func (b *builder) build() {
+ // Compute the sizes of the values.
+ var vmax uint64
+ for _, t := range b.Trie {
+ vmax = maxValue(t.root, vmax)
+ }
+ b.ValueType, b.ValueSize = getIntType(vmax)
+
+ // Compute all block allocations.
+ // TODO: first compute the ASCII blocks for all tries and then the other
+ // nodes. ASCII blocks are more restricted in placement, as they require two
+ // blocks to be placed consecutively. Processing them first may improve
+ // sharing (at least one zero block can be expected to be saved.)
+ for _, t := range b.Trie {
+ b.Checksum += b.buildTrie(t)
+ }
+
+ // Compute the offsets for all the Compacters.
+ offset := uint32(0)
+ for i := range b.Compactions {
+ c := &b.Compactions[i]
+ c.Offset = offset
+ offset += c.maxHandle + 1
+ c.Cutoff = offset
+ }
+
+ // Compute the sizes of indexes.
+ // TODO: different byte positions could have different sizes. So far we have
+ // not found a case where this is beneficial.
+ imax := uint64(b.Compactions[len(b.Compactions)-1].Cutoff)
+ for _, ib := range b.IndexBlocks {
+ if x := uint64(ib.index.index); x > imax {
+ imax = x
+ }
+ }
+ b.IndexType, b.IndexSize = getIntType(imax)
+}
+
+func maxValue(n *node, max uint64) uint64 {
+ if n == nil {
+ return max
+ }
+ for _, c := range n.children {
+ max = maxValue(c, max)
+ }
+ for _, v := range n.values {
+ if max < v {
+ max = v
+ }
+ }
+ return max
+}
+
+func getIntType(v uint64) (string, int) {
+ switch {
+ case v < 1<<8:
+ return "uint8", 1
+ case v < 1<<16:
+ return "uint16", 2
+ case v < 1<<32:
+ return "uint32", 4
+ }
+ return "uint64", 8
+}
+
+const (
+ blockSize = 64
+
+ // Subtract two blocks to offset 0x80, the first continuation byte.
+ blockOffset = 2
+
+ // Subtract three blocks to offset 0xC0, the first non-ASCII starter.
+ rootBlockOffset = 3
+)
+
+var crcTable = crc64.MakeTable(crc64.ISO)
+
+func (b *builder) buildTrie(t *Trie) uint64 {
+ n := t.root
+
+ // Get the ASCII offset. For the first trie, the ASCII block will be at
+ // position 0.
+ hasher := crc64.New(crcTable)
+ binary.Write(hasher, binary.BigEndian, n.values)
+ hash := hasher.Sum64()
+
+ v, ok := b.asciiBlockIdx[hash]
+ if !ok {
+ v = len(b.ValueBlocks)
+ b.asciiBlockIdx[hash] = v
+
+ b.ValueBlocks = append(b.ValueBlocks, n.values[:blockSize], n.values[blockSize:])
+ if v == 0 {
+ // Add the zero block at position 2 so that it will be assigned a
+ // zero reference in the lookup blocks.
+ // TODO: always do this? This would allow us to remove a check from
+ // the trie lookup, but at the expense of extra space. Analyze
+ // performance for unicode/norm.
+ b.ValueBlocks = append(b.ValueBlocks, make([]uint64, blockSize))
+ }
+ }
+ t.ASCIIIndex = v
+
+ // Compute remaining offsets.
+ t.Checksum = b.computeOffsets(n, true)
+ // We already subtracted the normal blockOffset from the index. Subtract the
+ // difference for starter bytes.
+ t.StarterIndex = n.index.index - (rootBlockOffset - blockOffset)
+ return t.Checksum
+}
+
+func (b *builder) computeOffsets(n *node, root bool) uint64 {
+ // For the first trie, the root lookup block will be at position 3, which is
+ // the offset for UTF-8 non-ASCII starter bytes.
+ first := len(b.IndexBlocks) == rootBlockOffset
+ if first {
+ b.IndexBlocks = append(b.IndexBlocks, n)
+ }
+
+ // We special-case the cases where all values recursively are 0. This allows
+ // for the use of a zero block to which all such values can be directed.
+ hash := uint64(0)
+ if n.children != nil || n.values != nil {
+ hasher := crc64.New(crcTable)
+ for _, c := range n.children {
+ var v uint64
+ if c != nil {
+ v = b.computeOffsets(c, false)
+ }
+ binary.Write(hasher, binary.BigEndian, v)
+ }
+ binary.Write(hasher, binary.BigEndian, n.values)
+ hash = hasher.Sum64()
+ }
+
+ if first {
+ b.indexBlockIdx[hash] = rootBlockOffset - blockOffset
+ }
+
+ // Compacters don't apply to internal nodes.
+ if n.children != nil {
+ v, ok := b.indexBlockIdx[hash]
+ if !ok {
+ v = len(b.IndexBlocks) - blockOffset
+ b.IndexBlocks = append(b.IndexBlocks, n)
+ b.indexBlockIdx[hash] = v
+ }
+ n.index = nodeIndex{0, v}
+ } else {
+ h, ok := b.valueBlockIdx[hash]
+ if !ok {
+ bestI, bestSize := 0, blockSize*b.ValueSize
+ for i, c := range b.Compactions[1:] {
+ if sz, ok := c.c.Size(n.values); ok && bestSize > sz {
+ bestI, bestSize = i+1, sz
+ }
+ }
+ c := &b.Compactions[bestI]
+ c.totalSize += bestSize
+ v := c.c.Store(n.values)
+ if c.maxHandle < v {
+ c.maxHandle = v
+ }
+ h = nodeIndex{bestI, int(v)}
+ b.valueBlockIdx[hash] = h
+ }
+ n.index = h
+ }
+ return hash
+}
diff --git a/src/dma/vendor/golang.org/x/text/internal/ucd/ucd.go b/src/dma/vendor/golang.org/x/text/internal/ucd/ucd.go
new file mode 100644
index 00000000..0879bc84
--- /dev/null
+++ b/src/dma/vendor/golang.org/x/text/internal/ucd/ucd.go
@@ -0,0 +1,371 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package ucd provides a parser for Unicode Character Database files, the
+// format of which is defined in https://www.unicode.org/reports/tr44/. See
+// https://www.unicode.org/Public/UCD/latest/ucd/ for example files.
+//
+// It currently does not support substitutions of missing fields.
+package ucd // import "golang.org/x/text/internal/ucd"
+
+import (
+ "bufio"
+ "errors"
+ "fmt"
+ "io"
+ "log"
+ "regexp"
+ "strconv"
+ "strings"
+)
+
+// UnicodeData.txt fields.
+const (
+ CodePoint = iota
+ Name
+ GeneralCategory
+ CanonicalCombiningClass
+ BidiClass
+ DecompMapping
+ DecimalValue
+ DigitValue
+ NumericValue
+ BidiMirrored
+ Unicode1Name
+ ISOComment
+ SimpleUppercaseMapping
+ SimpleLowercaseMapping
+ SimpleTitlecaseMapping
+)
+
+// Parse calls f for each entry in the given reader of a UCD file. It will close
+// the reader upon return. It will call log.Fatal if any error occurred.
+//
+// This implements the most common usage pattern of using Parser.
+func Parse(r io.ReadCloser, f func(p *Parser)) {
+ defer r.Close()
+
+ p := New(r)
+ for p.Next() {
+ f(p)
+ }
+ if err := p.Err(); err != nil {
+ r.Close() // os.Exit will cause defers not to be called.
+ log.Fatal(err)
+ }
+}
+
+// An Option is used to configure a Parser.
+type Option func(p *Parser)
+
+func keepRanges(p *Parser) {
+ p.keepRanges = true
+}
+
+var (
+ // KeepRanges prevents the expansion of ranges. The raw ranges can be
+ // obtained by calling Range(0) on the parser.
+ KeepRanges Option = keepRanges
+)
+
+// The Part option register a handler for lines starting with a '@'. The text
+// after a '@' is available as the first field. Comments are handled as usual.
+func Part(f func(p *Parser)) Option {
+ return func(p *Parser) {
+ p.partHandler = f
+ }
+}
+
+// The CommentHandler option passes comments that are on a line by itself to
+// a given handler.
+func CommentHandler(f func(s string)) Option {
+ return func(p *Parser) {
+ p.commentHandler = f
+ }
+}
+
+// A Parser parses Unicode Character Database (UCD) files.
+type Parser struct {
+ scanner *bufio.Scanner
+
+ keepRanges bool // Don't expand rune ranges in field 0.
+
+ err error
+ comment string
+ field []string
+ // parsedRange is needed in case Range(0) is called more than once for one
+ // field. In some cases this requires scanning ahead.
+ line int
+ parsedRange bool
+ rangeStart, rangeEnd rune
+
+ partHandler func(p *Parser)
+ commentHandler func(s string)
+}
+
+func (p *Parser) setError(err error, msg string) {
+ if p.err == nil && err != nil {
+ if msg == "" {
+ p.err = fmt.Errorf("ucd:line:%d: %v", p.line, err)
+ } else {
+ p.err = fmt.Errorf("ucd:line:%d:%s: %v", p.line, msg, err)
+ }
+ }
+}
+
+func (p *Parser) getField(i int) string {
+ if i >= len(p.field) {
+ return ""
+ }
+ return p.field[i]
+}
+
+// Err returns a non-nil error if any error occurred during parsing.
+func (p *Parser) Err() error {
+ return p.err
+}
+
+// New returns a Parser for the given Reader.
+func New(r io.Reader, o ...Option) *Parser {
+ p := &Parser{
+ scanner: bufio.NewScanner(r),
+ }
+ for _, f := range o {
+ f(p)
+ }
+ return p
+}
+
+// Next parses the next line in the file. It returns true if a line was parsed
+// and false if it reached the end of the file.
+func (p *Parser) Next() bool {
+ if !p.keepRanges && p.rangeStart < p.rangeEnd {
+ p.rangeStart++
+ return true
+ }
+ p.comment = ""
+ p.field = p.field[:0]
+ p.parsedRange = false
+
+ for p.scanner.Scan() && p.err == nil {
+ p.line++
+ s := p.scanner.Text()
+ if s == "" {
+ continue
+ }
+ if s[0] == '#' {
+ if p.commentHandler != nil {
+ p.commentHandler(strings.TrimSpace(s[1:]))
+ }
+ continue
+ }
+
+ // Parse line
+ if i := strings.IndexByte(s, '#'); i != -1 {
+ p.comment = strings.TrimSpace(s[i+1:])
+ s = s[:i]
+ }
+ if s[0] == '@' {
+ if p.partHandler != nil {
+ p.field = append(p.field, strings.TrimSpace(s[1:]))
+ p.partHandler(p)
+ p.field = p.field[:0]
+ }
+ p.comment = ""
+ continue
+ }
+ for {
+ i := strings.IndexByte(s, ';')
+ if i == -1 {
+ p.field = append(p.field, strings.TrimSpace(s))
+ break
+ }
+ p.field = append(p.field, strings.TrimSpace(s[:i]))
+ s = s[i+1:]
+ }
+ if !p.keepRanges {
+ p.rangeStart, p.rangeEnd = p.getRange(0)
+ }
+ return true
+ }
+ p.setError(p.scanner.Err(), "scanner failed")
+ return false
+}
+
+func parseRune(b string) (rune, error) {
+ if len(b) > 2 && b[0] == 'U' && b[1] == '+' {
+ b = b[2:]
+ }
+ x, err := strconv.ParseUint(b, 16, 32)
+ return rune(x), err
+}
+
+func (p *Parser) parseRune(s string) rune {
+ x, err := parseRune(s)
+ p.setError(err, "failed to parse rune")
+ return x
+}
+
+// Rune parses and returns field i as a rune.
+func (p *Parser) Rune(i int) rune {
+ if i > 0 || p.keepRanges {
+ return p.parseRune(p.getField(i))
+ }
+ return p.rangeStart
+}
+
+// Runes interprets and returns field i as a sequence of runes.
+func (p *Parser) Runes(i int) (runes []rune) {
+ add := func(s string) {
+ if s = strings.TrimSpace(s); len(s) > 0 {
+ runes = append(runes, p.parseRune(s))
+ }
+ }
+ for b := p.getField(i); ; {
+ i := strings.IndexByte(b, ' ')
+ if i == -1 {
+ add(b)
+ break
+ }
+ add(b[:i])
+ b = b[i+1:]
+ }
+ return
+}
+
+var (
+ errIncorrectLegacyRange = errors.New("ucd: unmatched <* First>")
+
+ // reRange matches one line of a legacy rune range.
+ reRange = regexp.MustCompile("^([0-9A-F]*);<([^,]*), ([^>]*)>(.*)$")
+)
+
+// Range parses and returns field i as a rune range. A range is inclusive at
+// both ends. If the field only has one rune, first and last will be identical.
+// It supports the legacy format for ranges used in UnicodeData.txt.
+func (p *Parser) Range(i int) (first, last rune) {
+ if !p.keepRanges {
+ return p.rangeStart, p.rangeStart
+ }
+ return p.getRange(i)
+}
+
+func (p *Parser) getRange(i int) (first, last rune) {
+ b := p.getField(i)
+ if k := strings.Index(b, ".."); k != -1 {
+ return p.parseRune(b[:k]), p.parseRune(b[k+2:])
+ }
+ // The first field may not be a rune, in which case we may ignore any error
+ // and set the range as 0..0.
+ x, err := parseRune(b)
+ if err != nil {
+ // Disable range parsing henceforth. This ensures that an error will be
+ // returned if the user subsequently will try to parse this field as
+ // a Rune.
+ p.keepRanges = true
+ }
+ // Special case for UnicodeData that was retained for backwards compatibility.
+ if i == 0 && len(p.field) > 1 && strings.HasSuffix(p.field[1], "First>") {
+ if p.parsedRange {
+ return p.rangeStart, p.rangeEnd
+ }
+ mf := reRange.FindStringSubmatch(p.scanner.Text())
+ p.line++
+ if mf == nil || !p.scanner.Scan() {
+ p.setError(errIncorrectLegacyRange, "")
+ return x, x
+ }
+ // Using Bytes would be more efficient here, but Text is a lot easier
+ // and this is not a frequent case.
+ ml := reRange.FindStringSubmatch(p.scanner.Text())
+ if ml == nil || mf[2] != ml[2] || ml[3] != "Last" || mf[4] != ml[4] {
+ p.setError(errIncorrectLegacyRange, "")
+ return x, x
+ }
+ p.rangeStart, p.rangeEnd = x, p.parseRune(p.scanner.Text()[:len(ml[1])])
+ p.parsedRange = true
+ return p.rangeStart, p.rangeEnd
+ }
+ return x, x
+}
+
+// bools recognizes all valid UCD boolean values.
+var bools = map[string]bool{
+ "": false,
+ "N": false,
+ "No": false,
+ "F": false,
+ "False": false,
+ "Y": true,
+ "Yes": true,
+ "T": true,
+ "True": true,
+}
+
+// Bool parses and returns field i as a boolean value.
+func (p *Parser) Bool(i int) bool {
+ f := p.getField(i)
+ for s, v := range bools {
+ if f == s {
+ return v
+ }
+ }
+ p.setError(strconv.ErrSyntax, "error parsing bool")
+ return false
+}
+
+// Int parses and returns field i as an integer value.
+func (p *Parser) Int(i int) int {
+ x, err := strconv.ParseInt(string(p.getField(i)), 10, 64)
+ p.setError(err, "error parsing int")
+ return int(x)
+}
+
+// Uint parses and returns field i as an unsigned integer value.
+func (p *Parser) Uint(i int) uint {
+ x, err := strconv.ParseUint(string(p.getField(i)), 10, 64)
+ p.setError(err, "error parsing uint")
+ return uint(x)
+}
+
+// Float parses and returns field i as a decimal value.
+func (p *Parser) Float(i int) float64 {
+ x, err := strconv.ParseFloat(string(p.getField(i)), 64)
+ p.setError(err, "error parsing float")
+ return x
+}
+
+// String parses and returns field i as a string value.
+func (p *Parser) String(i int) string {
+ return string(p.getField(i))
+}
+
+// Strings parses and returns field i as a space-separated list of strings.
+func (p *Parser) Strings(i int) []string {
+ ss := strings.Split(string(p.getField(i)), " ")
+ for i, s := range ss {
+ ss[i] = strings.TrimSpace(s)
+ }
+ return ss
+}
+
+// Comment returns the comments for the current line.
+func (p *Parser) Comment() string {
+ return string(p.comment)
+}
+
+var errUndefinedEnum = errors.New("ucd: undefined enum value")
+
+// Enum interprets and returns field i as a value that must be one of the values
+// in enum.
+func (p *Parser) Enum(i int, enum ...string) string {
+ f := p.getField(i)
+ for _, s := range enum {
+ if f == s {
+ return s
+ }
+ }
+ p.setError(errUndefinedEnum, "error parsing enum")
+ return ""
+}